Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A179HAT6

Protein Details
Accession A0A179HAT6    Localization Confidence Low Confidence Score 6.9
NoLS Segment(s)
PositionSequenceProtein Nature
30-55ASCARRRSCCSSRSRRRRAQVSVPLAHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 19, nucl 5.5, cyto_nucl 4
Family & Domain DBs
KEGG plj:VFPFJ_00685  -  
Amino Acid Sequences MPTRRTAVRDSPGASRRFPASRAGLVRHLASCARRRSCCSSRSRRRRAQVSVPLARRHRRLGHCPGPGPPATGERHGGLAELASPRMRADIRTCVARASGAHGGRLSQKLAYLQYSASGARWCAPSKGPSGSVARWSASSSTGAVVCAGMGTMPGW
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.48
2 0.43
3 0.42
4 0.4
5 0.38
6 0.36
7 0.34
8 0.38
9 0.41
10 0.41
11 0.4
12 0.39
13 0.4
14 0.33
15 0.3
16 0.27
17 0.28
18 0.32
19 0.36
20 0.41
21 0.42
22 0.48
23 0.55
24 0.58
25 0.61
26 0.64
27 0.66
28 0.71
29 0.79
30 0.84
31 0.83
32 0.86
33 0.86
34 0.83
35 0.82
36 0.8
37 0.78
38 0.76
39 0.72
40 0.69
41 0.67
42 0.65
43 0.58
44 0.54
45 0.54
46 0.52
47 0.55
48 0.58
49 0.6
50 0.59
51 0.57
52 0.53
53 0.48
54 0.42
55 0.36
56 0.27
57 0.22
58 0.2
59 0.2
60 0.19
61 0.16
62 0.16
63 0.14
64 0.13
65 0.09
66 0.07
67 0.07
68 0.06
69 0.06
70 0.06
71 0.06
72 0.06
73 0.08
74 0.08
75 0.08
76 0.11
77 0.17
78 0.19
79 0.21
80 0.21
81 0.2
82 0.2
83 0.19
84 0.16
85 0.15
86 0.19
87 0.17
88 0.18
89 0.17
90 0.18
91 0.21
92 0.22
93 0.18
94 0.12
95 0.13
96 0.14
97 0.16
98 0.16
99 0.14
100 0.12
101 0.12
102 0.13
103 0.13
104 0.12
105 0.11
106 0.1
107 0.12
108 0.15
109 0.16
110 0.17
111 0.2
112 0.22
113 0.25
114 0.28
115 0.27
116 0.28
117 0.32
118 0.31
119 0.34
120 0.33
121 0.29
122 0.27
123 0.27
124 0.24
125 0.2
126 0.2
127 0.15
128 0.15
129 0.14
130 0.14
131 0.12
132 0.11
133 0.09
134 0.07
135 0.07
136 0.04