Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A179HHY8

Protein Details
Accession A0A179HHY8    Localization Confidence Low Confidence Score 9.5
NoLS Segment(s)
PositionSequenceProtein Nature
52-77AAAFLFLRRRRRRHQLRRQNRTPAELHydrophilic
NLS Segment(s)
PositionSequence
59-69RRRRRRHQLRR
Subcellular Location(s) mito 13, nucl 4.5, cyto_nucl 4.5, cyto 3.5, plas 2, pero 2
Family & Domain DBs
Gene Ontology GO:0016020  C:membrane  
KEGG plj:VFPFJ_05502  -  
Amino Acid Sequences MAIVEWATTSVSPTPTPTPTPLSTPSASTAPSAGAIAGSVIGGVAFVLLVSAAAFLFLRRRRRRHQLRRQNRTPAELTDKTSPRSELETKERPQELVAPAQVSGGMYEMPG
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.2
2 0.22
3 0.25
4 0.26
5 0.3
6 0.29
7 0.33
8 0.33
9 0.35
10 0.32
11 0.31
12 0.3
13 0.26
14 0.25
15 0.21
16 0.17
17 0.12
18 0.12
19 0.1
20 0.07
21 0.06
22 0.05
23 0.04
24 0.04
25 0.03
26 0.03
27 0.02
28 0.02
29 0.02
30 0.02
31 0.02
32 0.01
33 0.01
34 0.01
35 0.01
36 0.02
37 0.02
38 0.02
39 0.02
40 0.02
41 0.03
42 0.03
43 0.09
44 0.13
45 0.24
46 0.31
47 0.38
48 0.45
49 0.56
50 0.68
51 0.74
52 0.81
53 0.82
54 0.86
55 0.9
56 0.91
57 0.91
58 0.81
59 0.75
60 0.66
61 0.59
62 0.56
63 0.48
64 0.44
65 0.42
66 0.42
67 0.39
68 0.39
69 0.36
70 0.29
71 0.33
72 0.33
73 0.32
74 0.38
75 0.44
76 0.45
77 0.51
78 0.51
79 0.45
80 0.42
81 0.42
82 0.36
83 0.34
84 0.33
85 0.26
86 0.25
87 0.24
88 0.23
89 0.17
90 0.14
91 0.09