Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A179H6U5

Protein Details
Accession A0A179H6U5    Localization Confidence Medium Confidence Score 10.3
NoLS Segment(s)
PositionSequenceProtein Nature
12-41GEPARRRCPANRGRRCRRRVLGPRKSLNRGBasic
NLS Segment(s)
PositionSequence
16-47RRRCPANRGRRCRRRVLGPRKSLNRGSRSGKR
Subcellular Location(s) mito 7, nucl 6, plas 6, cyto 3, E.R. 2, cyto_pero 2
Family & Domain DBs
KEGG plj:VFPFJ_08263  -  
Amino Acid Sequences MNGLRSTCRCGGEPARRRCPANRGRRCRRRVLGPRKSLNRGSRSGKRSGVCCDGTGRLLVIALVLVLLARVTTRDGGCQAGRLPGSRDGRPSNAHVLALKTPA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.61
2 0.66
3 0.68
4 0.71
5 0.69
6 0.7
7 0.69
8 0.7
9 0.71
10 0.72
11 0.79
12 0.86
13 0.87
14 0.86
15 0.83
16 0.82
17 0.83
18 0.83
19 0.82
20 0.81
21 0.84
22 0.8
23 0.79
24 0.76
25 0.72
26 0.66
27 0.62
28 0.59
29 0.59
30 0.56
31 0.55
32 0.53
33 0.47
34 0.44
35 0.42
36 0.4
37 0.32
38 0.29
39 0.26
40 0.22
41 0.2
42 0.18
43 0.13
44 0.08
45 0.07
46 0.06
47 0.04
48 0.03
49 0.02
50 0.02
51 0.02
52 0.02
53 0.02
54 0.02
55 0.02
56 0.02
57 0.03
58 0.04
59 0.07
60 0.07
61 0.09
62 0.1
63 0.14
64 0.14
65 0.16
66 0.16
67 0.18
68 0.18
69 0.19
70 0.21
71 0.26
72 0.31
73 0.31
74 0.36
75 0.36
76 0.4
77 0.42
78 0.43
79 0.42
80 0.39
81 0.39
82 0.35
83 0.34