Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A179HIN9

Protein Details
Accession A0A179HIN9    Localization Confidence Medium Confidence Score 13.8
NoLS Segment(s)
PositionSequenceProtein Nature
66-93GQWHRMQDDKYIRRPRRRNQDGTAPRTAHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 22, mito 3
Family & Domain DBs
KEGG plj:VFPFJ_05739  -  
Amino Acid Sequences MNDNNSKKNFASKSCVPDMLPSDYCALPRQSASLVPSPTACEGRSGDYMGPWHGRGCSGGDSRRPGQWHRMQDDKYIRRPRRRNQDGTAPRTAPCVV
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.51
2 0.53
3 0.44
4 0.43
5 0.43
6 0.4
7 0.34
8 0.28
9 0.27
10 0.25
11 0.26
12 0.24
13 0.21
14 0.16
15 0.16
16 0.16
17 0.14
18 0.15
19 0.17
20 0.2
21 0.19
22 0.18
23 0.18
24 0.18
25 0.19
26 0.18
27 0.15
28 0.12
29 0.13
30 0.15
31 0.16
32 0.15
33 0.13
34 0.13
35 0.13
36 0.12
37 0.13
38 0.1
39 0.1
40 0.09
41 0.09
42 0.09
43 0.1
44 0.13
45 0.16
46 0.18
47 0.22
48 0.27
49 0.28
50 0.31
51 0.32
52 0.3
53 0.36
54 0.41
55 0.45
56 0.45
57 0.52
58 0.5
59 0.56
60 0.64
61 0.61
62 0.64
63 0.66
64 0.71
65 0.73
66 0.82
67 0.83
68 0.84
69 0.87
70 0.85
71 0.82
72 0.84
73 0.84
74 0.81
75 0.79
76 0.69
77 0.59