Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A179GB28

Protein Details
Accession A0A179GB28    Localization Confidence Low Confidence Score 9
NoLS Segment(s)
PositionSequenceProtein Nature
1-21MAPQAKKSGKAQKQTKKFIINHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 14.5, cyto_nucl 11.5, cyto 7.5, mito 3
Family & Domain DBs
InterPro View protein in InterPro  
IPR002671  Ribosomal_L22e  
IPR038526  Ribosomal_L22e_sf  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
KEGG plj:VFPFJ_08510  -  
Pfam View protein in Pfam  
PF01776  Ribosomal_L22e  
Amino Acid Sequences MAPQAKKSGKAQKQTKKFIINAQQPASDKIFDVSAFEKFLQDRIKVEGRTNNLGDNVVIQQAGEGKIEVIAHNELSGRYLKYLTKKFLKKQQLRDWLRVVSTSRGVYELKFFNVVNDEADEDDE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.84
2 0.83
3 0.8
4 0.75
5 0.73
6 0.73
7 0.71
8 0.69
9 0.62
10 0.58
11 0.52
12 0.52
13 0.46
14 0.36
15 0.27
16 0.2
17 0.19
18 0.14
19 0.15
20 0.13
21 0.12
22 0.13
23 0.13
24 0.14
25 0.13
26 0.17
27 0.18
28 0.18
29 0.18
30 0.21
31 0.26
32 0.26
33 0.29
34 0.3
35 0.3
36 0.34
37 0.33
38 0.29
39 0.24
40 0.23
41 0.2
42 0.16
43 0.12
44 0.08
45 0.07
46 0.06
47 0.05
48 0.06
49 0.07
50 0.06
51 0.05
52 0.05
53 0.06
54 0.06
55 0.06
56 0.07
57 0.07
58 0.07
59 0.07
60 0.07
61 0.07
62 0.08
63 0.1
64 0.08
65 0.08
66 0.1
67 0.13
68 0.21
69 0.26
70 0.31
71 0.39
72 0.45
73 0.52
74 0.6
75 0.68
76 0.69
77 0.74
78 0.78
79 0.8
80 0.78
81 0.77
82 0.72
83 0.63
84 0.56
85 0.48
86 0.41
87 0.34
88 0.32
89 0.27
90 0.23
91 0.23
92 0.23
93 0.21
94 0.24
95 0.22
96 0.2
97 0.22
98 0.21
99 0.21
100 0.24
101 0.24
102 0.2
103 0.19
104 0.18