Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A179HPL3

Protein Details
Accession A0A179HPL3    Localization Confidence Low Confidence Score 8.7
NoLS Segment(s)
PositionSequenceProtein Nature
244-268GDEKRRAELKKTVKRHKAEEAKARVBasic
NLS Segment(s)
PositionSequence
246-267EKRRAELKKTVKRHKAEEAKAR
Subcellular Location(s) cyto 21.5, cyto_nucl 12.5, nucl 2.5
Family & Domain DBs
KEGG plj:VFPFJ_04125  -  
Amino Acid Sequences MSGLDSYTAGMTEVPENLFHTVLTVVDLHNDPSGGTRSYYVLGTHGTLEAAKVYSTVALQELGFHRDDFDDYAARPAPGAGAAASASTAAAVEQAVTAEAWPHGEGVLLFARAPAGHEFTIRIDTTPNNESLRARAGSTGSGGGALLLPDGARFLHYVLQTTVDYNVDRTGAAQTAEIEGAYVHRADAWTAAHRCLDRDDYAEYDSRGDAEFLGEWPYGEDVVVHAVADTGQNFQVAVKTPPHGDEKRRAELKKTVKRHKAEEAKARVGRDMTD
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.11
2 0.12
3 0.13
4 0.15
5 0.14
6 0.13
7 0.12
8 0.11
9 0.1
10 0.11
11 0.1
12 0.08
13 0.11
14 0.12
15 0.12
16 0.13
17 0.12
18 0.11
19 0.13
20 0.16
21 0.14
22 0.15
23 0.14
24 0.15
25 0.17
26 0.18
27 0.15
28 0.13
29 0.13
30 0.13
31 0.13
32 0.12
33 0.11
34 0.1
35 0.1
36 0.09
37 0.08
38 0.07
39 0.07
40 0.07
41 0.07
42 0.07
43 0.07
44 0.07
45 0.07
46 0.07
47 0.11
48 0.12
49 0.14
50 0.15
51 0.14
52 0.14
53 0.14
54 0.15
55 0.13
56 0.14
57 0.13
58 0.12
59 0.16
60 0.16
61 0.15
62 0.14
63 0.12
64 0.11
65 0.09
66 0.09
67 0.05
68 0.05
69 0.05
70 0.05
71 0.05
72 0.04
73 0.04
74 0.03
75 0.03
76 0.03
77 0.03
78 0.03
79 0.03
80 0.03
81 0.03
82 0.04
83 0.04
84 0.04
85 0.04
86 0.04
87 0.05
88 0.05
89 0.05
90 0.05
91 0.05
92 0.05
93 0.07
94 0.07
95 0.07
96 0.07
97 0.07
98 0.07
99 0.06
100 0.08
101 0.07
102 0.09
103 0.09
104 0.09
105 0.1
106 0.11
107 0.14
108 0.12
109 0.11
110 0.1
111 0.1
112 0.14
113 0.15
114 0.16
115 0.14
116 0.15
117 0.15
118 0.15
119 0.18
120 0.15
121 0.14
122 0.12
123 0.12
124 0.11
125 0.11
126 0.1
127 0.07
128 0.06
129 0.06
130 0.05
131 0.04
132 0.04
133 0.03
134 0.03
135 0.03
136 0.02
137 0.03
138 0.03
139 0.03
140 0.04
141 0.05
142 0.09
143 0.09
144 0.11
145 0.11
146 0.13
147 0.13
148 0.13
149 0.13
150 0.1
151 0.1
152 0.1
153 0.1
154 0.08
155 0.07
156 0.08
157 0.08
158 0.08
159 0.08
160 0.08
161 0.08
162 0.08
163 0.08
164 0.07
165 0.06
166 0.05
167 0.05
168 0.06
169 0.05
170 0.04
171 0.05
172 0.05
173 0.05
174 0.07
175 0.08
176 0.14
177 0.15
178 0.17
179 0.19
180 0.19
181 0.2
182 0.22
183 0.24
184 0.18
185 0.19
186 0.2
187 0.19
188 0.21
189 0.22
190 0.19
191 0.17
192 0.16
193 0.14
194 0.13
195 0.11
196 0.09
197 0.08
198 0.08
199 0.08
200 0.11
201 0.1
202 0.09
203 0.1
204 0.1
205 0.09
206 0.08
207 0.08
208 0.05
209 0.08
210 0.08
211 0.07
212 0.06
213 0.06
214 0.06
215 0.08
216 0.08
217 0.08
218 0.08
219 0.08
220 0.08
221 0.09
222 0.11
223 0.12
224 0.15
225 0.16
226 0.18
227 0.19
228 0.23
229 0.31
230 0.35
231 0.39
232 0.46
233 0.51
234 0.59
235 0.66
236 0.64
237 0.62
238 0.66
239 0.7
240 0.7
241 0.73
242 0.74
243 0.76
244 0.8
245 0.81
246 0.82
247 0.81
248 0.81
249 0.8
250 0.78
251 0.79
252 0.76
253 0.71
254 0.64