Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

I3EIS8

Protein Details
Accession I3EIS8   
Localization Confidence Low
Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
2-21ASDSAKRRIKRNTQFLRMLIHydrophilic
NLS Segment(s)
Subcellular Location(s) plas 14, mito 6, E.R. 4, vacu 3, cyto_mito 3, mito_nucl 3
Family & Domain DBs
InterPro View protein in InterPro  
IPR008506  SND2/TMEM208  
Gene Ontology GO:0005789  C:endoplasmic reticulum membrane  
Pfam View protein in Pfam  
PF05620  TMEM208_SND2  
PROSITE View protein in PROSITE  
PS51257  PROKAR_LIPOPROTEIN  
Amino Acid Sequences MASDSAKRRIKRNTQFLRMLIISAVAIGACTVIGNRIFRRTFLSIPLVASIIVEAIILGILGYLVNPKFIKTSRGLEIKDGGVDLHGRGLIRIFIDMLYTFYAVEVLGIFFGRKAFILMLIIPVTAYYEIFRRMTVQKKTQ
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.78
2 0.81
3 0.74
4 0.7
5 0.6
6 0.5
7 0.38
8 0.28
9 0.19
10 0.13
11 0.12
12 0.05
13 0.04
14 0.03
15 0.03
16 0.03
17 0.03
18 0.03
19 0.05
20 0.08
21 0.11
22 0.13
23 0.2
24 0.2
25 0.21
26 0.27
27 0.28
28 0.27
29 0.28
30 0.3
31 0.25
32 0.25
33 0.24
34 0.19
35 0.15
36 0.13
37 0.09
38 0.05
39 0.04
40 0.04
41 0.03
42 0.02
43 0.02
44 0.02
45 0.02
46 0.02
47 0.02
48 0.02
49 0.02
50 0.04
51 0.04
52 0.06
53 0.06
54 0.07
55 0.09
56 0.1
57 0.13
58 0.14
59 0.18
60 0.21
61 0.26
62 0.27
63 0.26
64 0.27
65 0.24
66 0.21
67 0.18
68 0.12
69 0.08
70 0.08
71 0.07
72 0.05
73 0.06
74 0.06
75 0.06
76 0.06
77 0.07
78 0.06
79 0.07
80 0.06
81 0.05
82 0.06
83 0.07
84 0.07
85 0.07
86 0.07
87 0.07
88 0.06
89 0.07
90 0.06
91 0.06
92 0.05
93 0.04
94 0.04
95 0.04
96 0.04
97 0.05
98 0.05
99 0.06
100 0.05
101 0.07
102 0.07
103 0.07
104 0.09
105 0.09
106 0.11
107 0.11
108 0.1
109 0.09
110 0.09
111 0.09
112 0.08
113 0.09
114 0.07
115 0.1
116 0.14
117 0.14
118 0.15
119 0.18
120 0.25
121 0.34