Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A179HF60

Protein Details
Accession A0A179HF60    Localization Confidence Medium Confidence Score 13.9
NoLS Segment(s)
PositionSequenceProtein Nature
1-34MAKSKNSSQHNQWRKAHRNPTKKPKTSRYPSLKGHydrophilic
NLS Segment(s)
PositionSequence
14-34RKAHRNPTKKPKTSRYPSLKG
37-58PKFRRNHRHALHGTEKALREAK
Subcellular Location(s) nucl 19, mito_nucl 12.833, cyto_nucl 11.333, mito 5.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR002673  Ribosomal_L29e  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
KEGG plj:VFPFJ_06625  -  
Pfam View protein in Pfam  
PF01779  Ribosomal_L29e  
Amino Acid Sequences MAKSKNSSQHNQWRKAHRNPTKKPKTSRYPSLKGCDPKFRRNHRHALHGTEKALREAKEGKRETV
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.8
2 0.83
3 0.84
4 0.83
5 0.84
6 0.85
7 0.89
8 0.89
9 0.88
10 0.87
11 0.86
12 0.86
13 0.83
14 0.83
15 0.81
16 0.78
17 0.75
18 0.71
19 0.68
20 0.64
21 0.59
22 0.6
23 0.56
24 0.57
25 0.62
26 0.67
27 0.7
28 0.7
29 0.77
30 0.7
31 0.75
32 0.7
33 0.68
34 0.65
35 0.59
36 0.55
37 0.49
38 0.47
39 0.41
40 0.42
41 0.34
42 0.32
43 0.36
44 0.41
45 0.46