Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A179HJK9

Protein Details
Accession A0A179HJK9    Localization Confidence High Confidence Score 21.6
NoLS Segment(s)
PositionSequenceProtein Nature
452-471SPDPQKRSPKPQAKARPPTPHydrophilic
586-607SSMPPPSLPKRQKSPRLLQTLRHydrophilic
615-647EDSERNQPKGHRHKLQRGKHKHHEGSRKRWREEBasic
NLS Segment(s)
PositionSequence
324-397ERRVKSRSVDATGPRPEPKPKPQEPKARQPSPTAAMDAPVRPKPAPAAKPAAVEPLVRPRPEPAAKPARPPVKP
456-485QKRSPKPQAKARPPTPPKPRGSHRLAAPEP
622-655PKGHRHKLQRGKHKHHEGSRKRWREEMLPRERKR
Subcellular Location(s) nucl 16.5, cyto_nucl 10.5, mito 5, cyto 3.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR011992  EF-hand-dom_pair  
IPR002048  EF_hand_dom  
IPR000261  EH_dom  
Gene Ontology GO:0030479  C:actin cortical patch  
GO:0010008  C:endosome membrane  
GO:0005886  C:plasma membrane  
GO:0003779  F:actin binding  
GO:0005509  F:calcium ion binding  
GO:0006897  P:endocytosis  
KEGG plj:VFPFJ_04805  -  
Pfam View protein in Pfam  
PF12763  EF-hand_4  
PROSITE View protein in PROSITE  
PS50222  EF_HAND_2  
PS50031  EH  
CDD cd00052  EH  
Amino Acid Sequences MNPAGLAAPPSSSSASPDSATSSAAAAALRGASLAFQKTRPAASSPPTQPHERRGGHAGGAALSAATGAASASASARSRSPARPGGAPRPHGTGGSSPAEVEAASAVAHVPPHGLVAARLHQLGGPSSPSSSSPSAPLSAAVQAQHHLLQQQHQQSPHLHFPGGGGGRAIDPKSPSFIAATLAASRSVSPGPKMAAPALRRKASAGAASTLSGGSDAPVDSGSIAPTGSLISMFERSGSDSAKRASPTGNVVGSAEAQRIAMGRYMAAPPRTLPSPRPATPPPATTVKPNKSSEAVPRQPLTPPPPITAQKSAAVSPAVSQPKERRVKSRSVDATGPRPEPKPKPQEPKARQPSPTAAMDAPVRPKPAPAAKPAAVEPLVRPRPEPAAKPARPPVKPLRIQPPTEPSVVRSTPEVLSPTPVRPVKPSLTPTVVLSPQGSRASPQVLSPPSPSPDPQKRSPKPQAKARPPTPPKPRGSHRLAAPEPSSGTRPRASSHTSRGQPKPEVYGPSSPRGSLGLAMRGRLTPPSLPTRRLSVSSAPSSPAMDIPRRHAPSSSPSNLQLDSLTSAIMAGSLASARLTPHNTGSSMPPPSLPKRQKSPRLLQTLRQPTNQQDEDSERNQPKGHRHKLQRGKHKHHEGSRKRWREEMLPRERKRYEAVWASNRGILLEQDSPTRSVASGIGQDASQYVANVVVRDIWKRSRLPEDELAEVWDVVDRERRGRLSKQEFVVGMWLIDQRLRGRKIPQRVTDSMWGSANGVMVRPPKGR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.2
2 0.22
3 0.21
4 0.21
5 0.23
6 0.21
7 0.21
8 0.18
9 0.15
10 0.13
11 0.13
12 0.12
13 0.08
14 0.08
15 0.08
16 0.07
17 0.06
18 0.06
19 0.06
20 0.1
21 0.14
22 0.16
23 0.17
24 0.22
25 0.25
26 0.28
27 0.3
28 0.31
29 0.32
30 0.35
31 0.44
32 0.45
33 0.51
34 0.53
35 0.59
36 0.59
37 0.61
38 0.66
39 0.59
40 0.57
41 0.54
42 0.53
43 0.45
44 0.43
45 0.36
46 0.26
47 0.24
48 0.19
49 0.12
50 0.09
51 0.08
52 0.05
53 0.04
54 0.03
55 0.03
56 0.03
57 0.03
58 0.04
59 0.05
60 0.08
61 0.1
62 0.11
63 0.13
64 0.17
65 0.23
66 0.27
67 0.34
68 0.38
69 0.4
70 0.46
71 0.52
72 0.58
73 0.61
74 0.62
75 0.57
76 0.55
77 0.53
78 0.46
79 0.42
80 0.34
81 0.31
82 0.3
83 0.27
84 0.21
85 0.2
86 0.2
87 0.17
88 0.14
89 0.08
90 0.05
91 0.05
92 0.05
93 0.05
94 0.06
95 0.06
96 0.06
97 0.06
98 0.06
99 0.07
100 0.07
101 0.07
102 0.08
103 0.12
104 0.16
105 0.17
106 0.17
107 0.16
108 0.17
109 0.18
110 0.18
111 0.16
112 0.14
113 0.13
114 0.14
115 0.15
116 0.15
117 0.19
118 0.2
119 0.19
120 0.19
121 0.21
122 0.21
123 0.2
124 0.2
125 0.16
126 0.16
127 0.17
128 0.15
129 0.14
130 0.13
131 0.15
132 0.15
133 0.15
134 0.15
135 0.15
136 0.19
137 0.26
138 0.33
139 0.36
140 0.36
141 0.38
142 0.4
143 0.45
144 0.47
145 0.42
146 0.34
147 0.3
148 0.29
149 0.33
150 0.3
151 0.24
152 0.16
153 0.15
154 0.16
155 0.19
156 0.19
157 0.13
158 0.15
159 0.15
160 0.19
161 0.19
162 0.18
163 0.16
164 0.16
165 0.16
166 0.15
167 0.15
168 0.12
169 0.13
170 0.12
171 0.12
172 0.11
173 0.11
174 0.12
175 0.13
176 0.13
177 0.14
178 0.16
179 0.17
180 0.18
181 0.19
182 0.23
183 0.25
184 0.34
185 0.38
186 0.39
187 0.38
188 0.37
189 0.38
190 0.34
191 0.34
192 0.26
193 0.22
194 0.2
195 0.2
196 0.19
197 0.16
198 0.13
199 0.09
200 0.07
201 0.05
202 0.05
203 0.05
204 0.05
205 0.05
206 0.05
207 0.05
208 0.06
209 0.06
210 0.05
211 0.05
212 0.05
213 0.05
214 0.05
215 0.04
216 0.04
217 0.04
218 0.06
219 0.07
220 0.07
221 0.08
222 0.08
223 0.1
224 0.11
225 0.13
226 0.13
227 0.15
228 0.17
229 0.2
230 0.2
231 0.19
232 0.19
233 0.19
234 0.22
235 0.23
236 0.21
237 0.18
238 0.18
239 0.17
240 0.17
241 0.15
242 0.12
243 0.08
244 0.07
245 0.07
246 0.07
247 0.08
248 0.08
249 0.07
250 0.07
251 0.08
252 0.11
253 0.14
254 0.14
255 0.14
256 0.13
257 0.16
258 0.19
259 0.19
260 0.19
261 0.24
262 0.3
263 0.32
264 0.38
265 0.37
266 0.42
267 0.43
268 0.42
269 0.38
270 0.36
271 0.35
272 0.36
273 0.44
274 0.43
275 0.47
276 0.47
277 0.45
278 0.43
279 0.45
280 0.45
281 0.46
282 0.44
283 0.4
284 0.4
285 0.39
286 0.38
287 0.4
288 0.36
289 0.34
290 0.31
291 0.29
292 0.34
293 0.36
294 0.38
295 0.38
296 0.35
297 0.3
298 0.3
299 0.28
300 0.23
301 0.21
302 0.16
303 0.13
304 0.18
305 0.18
306 0.17
307 0.2
308 0.23
309 0.32
310 0.4
311 0.41
312 0.43
313 0.44
314 0.53
315 0.53
316 0.59
317 0.53
318 0.48
319 0.51
320 0.46
321 0.48
322 0.43
323 0.42
324 0.35
325 0.34
326 0.36
327 0.38
328 0.44
329 0.47
330 0.51
331 0.59
332 0.65
333 0.74
334 0.74
335 0.79
336 0.8
337 0.76
338 0.69
339 0.63
340 0.58
341 0.51
342 0.45
343 0.36
344 0.26
345 0.22
346 0.21
347 0.19
348 0.19
349 0.17
350 0.18
351 0.15
352 0.16
353 0.18
354 0.24
355 0.25
356 0.25
357 0.3
358 0.29
359 0.31
360 0.31
361 0.29
362 0.23
363 0.21
364 0.17
365 0.21
366 0.23
367 0.21
368 0.21
369 0.2
370 0.26
371 0.29
372 0.29
373 0.28
374 0.36
375 0.37
376 0.41
377 0.46
378 0.47
379 0.45
380 0.49
381 0.5
382 0.49
383 0.52
384 0.52
385 0.55
386 0.53
387 0.55
388 0.52
389 0.49
390 0.42
391 0.4
392 0.35
393 0.27
394 0.27
395 0.25
396 0.23
397 0.18
398 0.17
399 0.16
400 0.17
401 0.17
402 0.11
403 0.14
404 0.16
405 0.15
406 0.2
407 0.21
408 0.2
409 0.21
410 0.25
411 0.25
412 0.28
413 0.3
414 0.28
415 0.29
416 0.28
417 0.27
418 0.26
419 0.24
420 0.2
421 0.17
422 0.14
423 0.15
424 0.15
425 0.14
426 0.12
427 0.13
428 0.14
429 0.14
430 0.14
431 0.16
432 0.17
433 0.18
434 0.2
435 0.21
436 0.2
437 0.21
438 0.22
439 0.25
440 0.33
441 0.37
442 0.43
443 0.52
444 0.55
445 0.64
446 0.73
447 0.74
448 0.72
449 0.77
450 0.78
451 0.78
452 0.83
453 0.78
454 0.79
455 0.76
456 0.79
457 0.79
458 0.77
459 0.72
460 0.7
461 0.71
462 0.69
463 0.69
464 0.65
465 0.59
466 0.59
467 0.54
468 0.51
469 0.45
470 0.38
471 0.32
472 0.28
473 0.26
474 0.19
475 0.22
476 0.2
477 0.2
478 0.21
479 0.24
480 0.28
481 0.31
482 0.36
483 0.41
484 0.45
485 0.52
486 0.55
487 0.56
488 0.54
489 0.5
490 0.49
491 0.44
492 0.42
493 0.37
494 0.41
495 0.38
496 0.4
497 0.39
498 0.33
499 0.3
500 0.26
501 0.24
502 0.19
503 0.17
504 0.19
505 0.19
506 0.2
507 0.2
508 0.19
509 0.19
510 0.17
511 0.18
512 0.12
513 0.16
514 0.25
515 0.28
516 0.31
517 0.32
518 0.36
519 0.36
520 0.37
521 0.36
522 0.32
523 0.34
524 0.34
525 0.34
526 0.3
527 0.29
528 0.27
529 0.24
530 0.21
531 0.19
532 0.21
533 0.22
534 0.26
535 0.34
536 0.37
537 0.37
538 0.35
539 0.34
540 0.37
541 0.44
542 0.43
543 0.36
544 0.35
545 0.37
546 0.36
547 0.34
548 0.26
549 0.18
550 0.16
551 0.13
552 0.1
553 0.08
554 0.07
555 0.06
556 0.06
557 0.04
558 0.03
559 0.03
560 0.03
561 0.03
562 0.04
563 0.04
564 0.05
565 0.09
566 0.12
567 0.13
568 0.17
569 0.19
570 0.19
571 0.2
572 0.24
573 0.26
574 0.25
575 0.24
576 0.24
577 0.27
578 0.32
579 0.42
580 0.45
581 0.47
582 0.56
583 0.65
584 0.73
585 0.76
586 0.81
587 0.8
588 0.83
589 0.79
590 0.74
591 0.75
592 0.75
593 0.7
594 0.64
595 0.57
596 0.52
597 0.58
598 0.54
599 0.44
600 0.37
601 0.39
602 0.41
603 0.41
604 0.45
605 0.38
606 0.38
607 0.4
608 0.41
609 0.46
610 0.51
611 0.58
612 0.59
613 0.67
614 0.75
615 0.82
616 0.87
617 0.88
618 0.88
619 0.88
620 0.89
621 0.9
622 0.88
623 0.87
624 0.89
625 0.87
626 0.87
627 0.89
628 0.88
629 0.79
630 0.76
631 0.7
632 0.69
633 0.69
634 0.69
635 0.69
636 0.71
637 0.72
638 0.75
639 0.73
640 0.66
641 0.6
642 0.52
643 0.5
644 0.49
645 0.53
646 0.52
647 0.56
648 0.55
649 0.52
650 0.49
651 0.4
652 0.31
653 0.24
654 0.2
655 0.18
656 0.17
657 0.19
658 0.2
659 0.21
660 0.21
661 0.21
662 0.17
663 0.15
664 0.15
665 0.15
666 0.16
667 0.16
668 0.16
669 0.14
670 0.14
671 0.13
672 0.14
673 0.11
674 0.09
675 0.08
676 0.1
677 0.11
678 0.11
679 0.11
680 0.14
681 0.15
682 0.19
683 0.23
684 0.26
685 0.32
686 0.35
687 0.41
688 0.46
689 0.48
690 0.52
691 0.56
692 0.53
693 0.5
694 0.47
695 0.44
696 0.35
697 0.31
698 0.23
699 0.17
700 0.14
701 0.12
702 0.19
703 0.19
704 0.22
705 0.28
706 0.33
707 0.36
708 0.44
709 0.53
710 0.55
711 0.61
712 0.6
713 0.6
714 0.56
715 0.5
716 0.47
717 0.36
718 0.27
719 0.21
720 0.2
721 0.15
722 0.16
723 0.18
724 0.21
725 0.29
726 0.34
727 0.37
728 0.45
729 0.53
730 0.62
731 0.69
732 0.71
733 0.7
734 0.7
735 0.71
736 0.7
737 0.65
738 0.57
739 0.49
740 0.41
741 0.33
742 0.31
743 0.27
744 0.19
745 0.16
746 0.17
747 0.2