Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A179H4V9

Protein Details
Accession A0A179H4V9   
Localization Confidence Medium
Confidence Score 13.7
NoLS Segment(s)
PositionSequenceProtein Nature
66-86SIDTVWKTRRHKGSCRCLAYGHydrophilic
410-435EDGVAEMKRRAKRRKEAQSSKLGPMGHydrophilic
NLS Segment(s)
PositionSequence
417-425KRRAKRRKE
Subcellular Location(s) cyto 12, nucl 10, cysk 2, mito 1, extr 1, pero 1
Family & Domain DBs
InterPro View protein in InterPro  
IPR015943  WD40/YVTN_repeat-like_dom_sf  
IPR001680  WD40_repeat  
IPR036322  WD40_repeat_dom_sf  
KEGG plj:VFPFJ_07603  -  
Amino Acid Sequences MFENLCTLPLQADVFATALHPTEPLLTVGLASGHVETFRLPPSGSADEGDDDADADTSVLSDGRGSIDTVWKTRRHKGSCRCLAYGHDGRSLYSAGTDAVVKQFDPLTGQVASKLAISSTTTVPDAPTLLHVLNPQALLLATDSGALHIFDLRDADGGPKSRRPAQTHFPHADYVSSVTPLPPSEESTSGFPKQWVSTGGTTLAVTDVRRGVLVRSEDQEDELLSSCFMPGMGPKKNRNNGVVAVGSGSGVLTLWDKGAWDDQQERIIVDGGLGGMKGRKGAAAAGGESIDAIVRVPQEMGLGKKVVCGMGDGSLRVVDLVRREVNVSANLRHDDMEGVVSLEFDSANRLISAGGRTVKVWEELSELQGGNDEEEDEDDEDDEDDDAGRNSAKRAADSDGDDDDDDSDEEDGVAEMKRRAKRRKEAQSSKLGPMGAHGVLGFEGMD
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.1
2 0.1
3 0.1
4 0.09
5 0.09
6 0.08
7 0.08
8 0.08
9 0.1
10 0.11
11 0.11
12 0.11
13 0.1
14 0.1
15 0.1
16 0.1
17 0.08
18 0.08
19 0.08
20 0.07
21 0.07
22 0.08
23 0.09
24 0.11
25 0.13
26 0.14
27 0.14
28 0.15
29 0.21
30 0.24
31 0.23
32 0.22
33 0.21
34 0.2
35 0.21
36 0.19
37 0.13
38 0.1
39 0.1
40 0.09
41 0.07
42 0.06
43 0.05
44 0.05
45 0.05
46 0.05
47 0.05
48 0.05
49 0.05
50 0.07
51 0.08
52 0.08
53 0.1
54 0.17
55 0.19
56 0.24
57 0.29
58 0.35
59 0.4
60 0.48
61 0.57
62 0.58
63 0.66
64 0.72
65 0.77
66 0.8
67 0.81
68 0.73
69 0.65
70 0.61
71 0.6
72 0.56
73 0.48
74 0.43
75 0.37
76 0.36
77 0.36
78 0.32
79 0.23
80 0.16
81 0.13
82 0.08
83 0.09
84 0.09
85 0.08
86 0.1
87 0.1
88 0.1
89 0.1
90 0.11
91 0.1
92 0.12
93 0.12
94 0.12
95 0.13
96 0.13
97 0.13
98 0.13
99 0.13
100 0.12
101 0.11
102 0.08
103 0.07
104 0.09
105 0.1
106 0.11
107 0.12
108 0.12
109 0.12
110 0.12
111 0.12
112 0.11
113 0.09
114 0.09
115 0.09
116 0.09
117 0.1
118 0.11
119 0.11
120 0.12
121 0.12
122 0.1
123 0.09
124 0.08
125 0.08
126 0.07
127 0.07
128 0.05
129 0.06
130 0.06
131 0.06
132 0.06
133 0.06
134 0.05
135 0.06
136 0.06
137 0.06
138 0.07
139 0.06
140 0.06
141 0.07
142 0.08
143 0.1
144 0.14
145 0.17
146 0.19
147 0.22
148 0.29
149 0.36
150 0.4
151 0.43
152 0.49
153 0.55
154 0.6
155 0.6
156 0.55
157 0.5
158 0.44
159 0.38
160 0.29
161 0.22
162 0.14
163 0.12
164 0.1
165 0.09
166 0.1
167 0.09
168 0.11
169 0.1
170 0.12
171 0.14
172 0.15
173 0.16
174 0.18
175 0.22
176 0.21
177 0.21
178 0.18
179 0.18
180 0.17
181 0.17
182 0.16
183 0.15
184 0.15
185 0.15
186 0.15
187 0.14
188 0.13
189 0.12
190 0.1
191 0.08
192 0.07
193 0.07
194 0.07
195 0.07
196 0.07
197 0.07
198 0.07
199 0.1
200 0.12
201 0.13
202 0.14
203 0.16
204 0.16
205 0.16
206 0.16
207 0.12
208 0.1
209 0.09
210 0.08
211 0.06
212 0.06
213 0.05
214 0.05
215 0.05
216 0.04
217 0.06
218 0.11
219 0.18
220 0.23
221 0.3
222 0.39
223 0.44
224 0.47
225 0.47
226 0.44
227 0.39
228 0.37
229 0.3
230 0.22
231 0.17
232 0.14
233 0.12
234 0.08
235 0.07
236 0.03
237 0.03
238 0.03
239 0.03
240 0.04
241 0.04
242 0.04
243 0.04
244 0.05
245 0.07
246 0.07
247 0.1
248 0.11
249 0.13
250 0.15
251 0.15
252 0.15
253 0.13
254 0.13
255 0.1
256 0.08
257 0.07
258 0.05
259 0.05
260 0.05
261 0.04
262 0.04
263 0.05
264 0.05
265 0.05
266 0.05
267 0.06
268 0.06
269 0.09
270 0.09
271 0.09
272 0.09
273 0.09
274 0.09
275 0.08
276 0.08
277 0.05
278 0.04
279 0.03
280 0.04
281 0.04
282 0.05
283 0.05
284 0.05
285 0.07
286 0.09
287 0.1
288 0.11
289 0.12
290 0.12
291 0.13
292 0.14
293 0.13
294 0.11
295 0.11
296 0.09
297 0.12
298 0.13
299 0.12
300 0.12
301 0.11
302 0.11
303 0.1
304 0.1
305 0.07
306 0.08
307 0.13
308 0.14
309 0.14
310 0.16
311 0.17
312 0.19
313 0.23
314 0.24
315 0.22
316 0.24
317 0.25
318 0.25
319 0.24
320 0.22
321 0.17
322 0.15
323 0.13
324 0.09
325 0.09
326 0.08
327 0.07
328 0.07
329 0.06
330 0.06
331 0.05
332 0.08
333 0.07
334 0.08
335 0.08
336 0.08
337 0.08
338 0.1
339 0.12
340 0.13
341 0.15
342 0.15
343 0.15
344 0.17
345 0.19
346 0.19
347 0.18
348 0.15
349 0.18
350 0.18
351 0.2
352 0.21
353 0.19
354 0.16
355 0.18
356 0.18
357 0.13
358 0.12
359 0.11
360 0.08
361 0.09
362 0.11
363 0.09
364 0.09
365 0.09
366 0.09
367 0.09
368 0.1
369 0.09
370 0.07
371 0.07
372 0.07
373 0.07
374 0.08
375 0.09
376 0.1
377 0.11
378 0.17
379 0.17
380 0.18
381 0.21
382 0.24
383 0.26
384 0.28
385 0.3
386 0.27
387 0.27
388 0.25
389 0.23
390 0.2
391 0.17
392 0.14
393 0.11
394 0.1
395 0.08
396 0.08
397 0.08
398 0.07
399 0.07
400 0.08
401 0.1
402 0.14
403 0.22
404 0.29
405 0.39
406 0.49
407 0.59
408 0.68
409 0.77
410 0.84
411 0.88
412 0.91
413 0.9
414 0.91
415 0.86
416 0.8
417 0.73
418 0.63
419 0.51
420 0.43
421 0.38
422 0.27
423 0.22
424 0.17
425 0.14
426 0.13