Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

I3EIN4

Protein Details
Accession I3EIN4    Localization Confidence Medium Confidence Score 10.3
NoLS Segment(s)
PositionSequenceProtein Nature
172-197VAVRKESKKERIKERKKNCIKEHKFLBasic
NLS Segment(s)
PositionSequence
173-188AVRKESKKERIKERKK
Subcellular Location(s) cyto 17.5, cyto_nucl 14, nucl 9.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR029058  AB_hydrolase  
IPR003386  LACT/PDAT_acylTrfase  
Gene Ontology GO:0008374  F:O-acyltransferase activity  
GO:0006629  P:lipid metabolic process  
Pfam View protein in Pfam  
PF02450  LCAT  
Amino Acid Sequences MWFWWKIVENLSYIGYDVADIHFAAFDWRLGIEELEIRDNYFTKLKIDIETQYIRKKEKVLVVAHSMGSLIFHYFMQWVSEKDPKWVDKYVHSSVYIGPPLLGAPKALGGLLAGEVKDTVDMGVIQYTIVELLFGKKNRHELFKTWGSLLHLLPKGGERIWKRKDSDKLDLVAVRKESKKERIKERKKNCIKEHKFLSYSDIFSIIKEILPSYNKQLHEKIVIPKKKQDKWSNPLECALPNAPNLTIYSLYGVNKSTESGYYFIDANGTLKIDRNISSRSNNVYNGVVLKDGDGTVPVVSLGYMGISGWKKKSLNPYGVKTVNREYKHVPSTSILEVRGGKYTAEHVNILGNIDLIRDILEISSGKTLPNKILSNLQEIADEIDKKTI
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.17
2 0.13
3 0.11
4 0.1
5 0.09
6 0.08
7 0.08
8 0.08
9 0.08
10 0.08
11 0.1
12 0.09
13 0.09
14 0.09
15 0.09
16 0.1
17 0.1
18 0.11
19 0.1
20 0.13
21 0.15
22 0.18
23 0.18
24 0.17
25 0.18
26 0.19
27 0.21
28 0.21
29 0.2
30 0.18
31 0.22
32 0.23
33 0.24
34 0.27
35 0.26
36 0.29
37 0.35
38 0.38
39 0.42
40 0.45
41 0.45
42 0.45
43 0.46
44 0.46
45 0.47
46 0.49
47 0.46
48 0.46
49 0.48
50 0.47
51 0.43
52 0.36
53 0.29
54 0.21
55 0.17
56 0.13
57 0.08
58 0.07
59 0.07
60 0.07
61 0.08
62 0.08
63 0.11
64 0.12
65 0.13
66 0.16
67 0.22
68 0.22
69 0.27
70 0.33
71 0.33
72 0.36
73 0.39
74 0.38
75 0.39
76 0.45
77 0.45
78 0.42
79 0.4
80 0.36
81 0.33
82 0.36
83 0.29
84 0.22
85 0.17
86 0.14
87 0.14
88 0.15
89 0.12
90 0.07
91 0.07
92 0.07
93 0.07
94 0.07
95 0.06
96 0.05
97 0.05
98 0.06
99 0.06
100 0.05
101 0.05
102 0.05
103 0.05
104 0.05
105 0.05
106 0.04
107 0.04
108 0.04
109 0.04
110 0.05
111 0.05
112 0.05
113 0.04
114 0.04
115 0.04
116 0.04
117 0.04
118 0.03
119 0.07
120 0.12
121 0.14
122 0.17
123 0.19
124 0.28
125 0.3
126 0.37
127 0.37
128 0.35
129 0.41
130 0.44
131 0.44
132 0.36
133 0.35
134 0.31
135 0.3
136 0.27
137 0.27
138 0.21
139 0.19
140 0.19
141 0.19
142 0.18
143 0.16
144 0.21
145 0.19
146 0.28
147 0.34
148 0.39
149 0.41
150 0.47
151 0.55
152 0.56
153 0.59
154 0.53
155 0.49
156 0.45
157 0.45
158 0.39
159 0.32
160 0.27
161 0.24
162 0.22
163 0.24
164 0.27
165 0.34
166 0.41
167 0.46
168 0.56
169 0.63
170 0.72
171 0.79
172 0.83
173 0.85
174 0.86
175 0.88
176 0.86
177 0.86
178 0.82
179 0.79
180 0.75
181 0.7
182 0.62
183 0.52
184 0.48
185 0.39
186 0.34
187 0.26
188 0.23
189 0.17
190 0.15
191 0.16
192 0.11
193 0.09
194 0.08
195 0.08
196 0.08
197 0.1
198 0.11
199 0.15
200 0.2
201 0.21
202 0.24
203 0.26
204 0.26
205 0.27
206 0.31
207 0.34
208 0.38
209 0.43
210 0.42
211 0.48
212 0.54
213 0.57
214 0.63
215 0.65
216 0.65
217 0.65
218 0.74
219 0.71
220 0.63
221 0.59
222 0.51
223 0.4
224 0.34
225 0.3
226 0.2
227 0.16
228 0.16
229 0.14
230 0.13
231 0.13
232 0.11
233 0.1
234 0.09
235 0.1
236 0.11
237 0.11
238 0.12
239 0.12
240 0.12
241 0.11
242 0.12
243 0.11
244 0.1
245 0.11
246 0.12
247 0.12
248 0.12
249 0.12
250 0.11
251 0.11
252 0.1
253 0.09
254 0.08
255 0.09
256 0.08
257 0.09
258 0.11
259 0.12
260 0.14
261 0.17
262 0.2
263 0.23
264 0.26
265 0.28
266 0.32
267 0.34
268 0.33
269 0.31
270 0.28
271 0.25
272 0.23
273 0.2
274 0.16
275 0.12
276 0.11
277 0.1
278 0.09
279 0.08
280 0.07
281 0.07
282 0.06
283 0.06
284 0.06
285 0.05
286 0.05
287 0.05
288 0.04
289 0.03
290 0.03
291 0.03
292 0.08
293 0.11
294 0.14
295 0.16
296 0.22
297 0.23
298 0.28
299 0.39
300 0.42
301 0.5
302 0.54
303 0.58
304 0.61
305 0.66
306 0.63
307 0.58
308 0.58
309 0.57
310 0.51
311 0.5
312 0.47
313 0.5
314 0.54
315 0.5
316 0.43
317 0.38
318 0.4
319 0.41
320 0.39
321 0.3
322 0.28
323 0.3
324 0.29
325 0.29
326 0.25
327 0.2
328 0.18
329 0.22
330 0.24
331 0.24
332 0.23
333 0.2
334 0.22
335 0.23
336 0.23
337 0.18
338 0.14
339 0.11
340 0.11
341 0.1
342 0.07
343 0.07
344 0.06
345 0.06
346 0.06
347 0.08
348 0.08
349 0.1
350 0.14
351 0.14
352 0.15
353 0.2
354 0.22
355 0.25
356 0.32
357 0.33
358 0.31
359 0.39
360 0.41
361 0.42
362 0.42
363 0.37
364 0.31
365 0.29
366 0.3
367 0.26
368 0.25