Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

I3EHX3

Protein Details
Accession I3EHX3   
Localization Confidence Medium
Confidence Score 14.4
NoLS Segment(s)
PositionSequenceProtein Nature
98-129GKEITKLPRKLRKEDKNKKKKIRGTIAALQKKBasic
NLS Segment(s)
PositionSequence
94-134KDKEGKEITKLPRKLRKEDKNKKKKIRGTIAALQKKVEKRQ
Subcellular Location(s) nucl 24.5, cyto_nucl 13.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR012678  Ribosomal_L23/L15e_core_dom_sf  
IPR001976  Ribosomal_S24e  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF01282  Ribosomal_S24e  
Amino Acid Sequences MTNTIKILEKKQNPLLDRMELSLSVYHPCSGTPNKKEISKMLSEQLNTSTDNIVVKDCYTRFGTHISSAAAKIYNKKSSLEKIEHKFILNRIIKDKEGKEITKLPRKLRKEDKNKKKKIRGTIAALQKKVEKRQQRQ
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.6
2 0.57
3 0.51
4 0.46
5 0.4
6 0.34
7 0.27
8 0.26
9 0.21
10 0.18
11 0.16
12 0.15
13 0.14
14 0.13
15 0.13
16 0.17
17 0.24
18 0.32
19 0.34
20 0.39
21 0.42
22 0.45
23 0.47
24 0.45
25 0.42
26 0.37
27 0.35
28 0.34
29 0.34
30 0.31
31 0.3
32 0.28
33 0.24
34 0.2
35 0.19
36 0.14
37 0.12
38 0.12
39 0.12
40 0.1
41 0.09
42 0.09
43 0.11
44 0.1
45 0.12
46 0.14
47 0.14
48 0.14
49 0.17
50 0.18
51 0.16
52 0.17
53 0.15
54 0.13
55 0.13
56 0.12
57 0.11
58 0.1
59 0.15
60 0.18
61 0.21
62 0.22
63 0.24
64 0.26
65 0.3
66 0.35
67 0.36
68 0.4
69 0.4
70 0.45
71 0.44
72 0.42
73 0.39
74 0.35
75 0.39
76 0.35
77 0.33
78 0.32
79 0.34
80 0.35
81 0.38
82 0.38
83 0.36
84 0.37
85 0.36
86 0.35
87 0.4
88 0.47
89 0.51
90 0.56
91 0.57
92 0.62
93 0.66
94 0.72
95 0.74
96 0.76
97 0.78
98 0.84
99 0.86
100 0.88
101 0.93
102 0.94
103 0.94
104 0.91
105 0.91
106 0.9
107 0.87
108 0.84
109 0.82
110 0.82
111 0.79
112 0.72
113 0.64
114 0.6
115 0.58
116 0.59
117 0.6