FuNGI

A0A179GDC0

Protein Details

Accession

A0A179GDC0

Localization Confidence

Medium

Confidence Score

NoLS Segment(s)

Position	Sequence	Protein Nature
412-436	AWQRHVKGASHRRAMKKKTKLALVP	Hydrophilic

NLS Segment(s)

Position	Sequence
421-429	SHRRAMKKK

Subcellular Location(s)

mito 11, cyto 6, nucl 5, pero 3

Family & Domain DBs

InterPro	View protein in InterPro IPR039657 Dimethylallyltransferase IPR030666 IPP_transferase_euk IPR018022 IPT IPR027417 P-loop_NTPase IPR036236 Znf_C2H2_sf
Gene Ontology	GO:0005737 C:cytoplasm GO:0005524 F:ATP binding GO:0052381 F:tRNA dimethylallyltransferase activity GO:0008033 P:tRNA processing
KEGG	plj:VFPFJ_10806 -
Pfam	View protein in Pfam PF01715 IPPT

Amino Acid Sequences

MAARRPVEPLLVVLGSTGTGKSDLAVELATRFSGEVINADAMQLYRGLPIITNKITPQEQRGVPHHLLGHIGLDATPWDVEDFKREATRVMSEIRSRGNLPILVGGTQYYVDPLLFTDVILDQVQQQQADGPDKPSFPILEEPTEVLLEELRKCDPVMAERWHPNDRRKIQRSLEIFLHTGKPASQFYDEQRERKAAAQEAGAAGPPWEKLLFWVDADKEVLRERLDGRVDKMLDAGLLAEVRELYDFKRDMAAKGAQLDMTKGIWQSIGYKQFEPYLAALDRGEDVPADDLAALKARAVEDMKTATRRYANYQTRWIRLKQIRHLREEGPAALRSLYLVDSTDAAKFHEHVVAPAADVTARFLAGEPCPDPATLSERAREVLTVAVEPPPPETPVRRTCELCQTVLVTEQAWQRHVKGASHRRAMKKKTKLALVPVEETGQDSSQGATPPSSPDIGSLF

FASTA Sequence
with NoLS information

AlphaFold Structure
with highlighted NoLS

NoLS Predictions per Residue

Residue Number	Score
1	0.13
2	0.11
3	0.11
4	0.1
5	0.07
6	0.07
7	0.07
8	0.08
9	0.09
10	0.09
11	0.09
12	0.1
13	0.09
14	0.1
15	0.11
16	0.1
17	0.09
18	0.08
19	0.08
20	0.09
21	0.09
22	0.09
23	0.11
24	0.12
25	0.12
26	0.12
27	0.12
28	0.11
29	0.11
30	0.1
31	0.08
32	0.07
33	0.08
34	0.09
35	0.1
36	0.14
37	0.2
38	0.21
39	0.23
40	0.23
41	0.28
42	0.32
43	0.33
44	0.35
45	0.37
46	0.38
47	0.42
48	0.46
49	0.48
50	0.44
51	0.45
52	0.41
53	0.33
54	0.32
55	0.26
56	0.22
57	0.14
58	0.14
59	0.1
60	0.08
61	0.08
62	0.07
63	0.07
64	0.06
65	0.07
66	0.08
67	0.08
68	0.13
69	0.15
70	0.16
71	0.19
72	0.19
73	0.2
74	0.22
75	0.25
76	0.22
77	0.25
78	0.27
79	0.27
80	0.3
81	0.31
82	0.31
83	0.29
84	0.29
85	0.28
86	0.24
87	0.22
88	0.22
89	0.2
90	0.18
91	0.16
92	0.14
93	0.11
94	0.1
95	0.09
96	0.07
97	0.06
98	0.06
99	0.06
100	0.06
101	0.09
102	0.08
103	0.08
104	0.09
105	0.08
106	0.1
107	0.11
108	0.1
109	0.09
110	0.13
111	0.14
112	0.13
113	0.13
114	0.13
115	0.16
116	0.19
117	0.19
118	0.18
119	0.19
120	0.2
121	0.21
122	0.2
123	0.17
124	0.16
125	0.21
126	0.2
127	0.2
128	0.2
129	0.2
130	0.2
131	0.19
132	0.17
133	0.11
134	0.1
135	0.1
136	0.1
137	0.11
138	0.11
139	0.11
140	0.11
141	0.13
142	0.13
143	0.14
144	0.19
145	0.22
146	0.27
147	0.32
148	0.36
149	0.42
150	0.46
151	0.49
152	0.54
153	0.58
154	0.63
155	0.64
156	0.67
157	0.64
158	0.67
159	0.63
160	0.57
161	0.51
162	0.43
163	0.38
164	0.31
165	0.29
166	0.21
167	0.18
168	0.15
169	0.15
170	0.13
171	0.15
172	0.16
173	0.16
174	0.19
175	0.29
176	0.31
177	0.3
178	0.32
179	0.31
180	0.3
181	0.31
182	0.32
183	0.24
184	0.23
185	0.21
186	0.2
187	0.19
188	0.18
189	0.14
190	0.1
191	0.07
192	0.06
193	0.06
194	0.06
195	0.05
196	0.05
197	0.06
198	0.09
199	0.09
200	0.09
201	0.11
202	0.11
203	0.11
204	0.13
205	0.11
206	0.1
207	0.1
208	0.11
209	0.09
210	0.11
211	0.11
212	0.15
213	0.17
214	0.17
215	0.18
216	0.21
217	0.21
218	0.19
219	0.18
220	0.14
221	0.11
222	0.1
223	0.08
224	0.04
225	0.04
226	0.03
227	0.03
228	0.03
229	0.03
230	0.04
231	0.04
232	0.04
233	0.09
234	0.1
235	0.1
236	0.15
237	0.15
238	0.16
239	0.19
240	0.21
241	0.17
242	0.18
243	0.18
244	0.14
245	0.14
246	0.14
247	0.1
248	0.09
249	0.09
250	0.08
251	0.08
252	0.07
253	0.07
254	0.1
255	0.14
256	0.2
257	0.21
258	0.22
259	0.22
260	0.24
261	0.24
262	0.22
263	0.17
264	0.15
265	0.13
266	0.13
267	0.13
268	0.12
269	0.12
270	0.11
271	0.1
272	0.06
273	0.06
274	0.06
275	0.06
276	0.06
277	0.05
278	0.05
279	0.05
280	0.07
281	0.06
282	0.05
283	0.07
284	0.07
285	0.09
286	0.09
287	0.1
288	0.1
289	0.14
290	0.16
291	0.18
292	0.18
293	0.2
294	0.23
295	0.24
296	0.29
297	0.36
298	0.42
299	0.43
300	0.52
301	0.55
302	0.57
303	0.6
304	0.55
305	0.55
306	0.53
307	0.57
308	0.57
309	0.63
310	0.62
311	0.64
312	0.66
313	0.58
314	0.55
315	0.5
316	0.43
317	0.35
318	0.3
319	0.25
320	0.21
321	0.19
322	0.14
323	0.13
324	0.11
325	0.07
326	0.07
327	0.07
328	0.08
329	0.09
330	0.1
331	0.1
332	0.1
333	0.11
334	0.11
335	0.12
336	0.15
337	0.14
338	0.13
339	0.16
340	0.16
341	0.15
342	0.14
343	0.13
344	0.09
345	0.09
346	0.1
347	0.07
348	0.07
349	0.07
350	0.07
351	0.1
352	0.11
353	0.14
354	0.13
355	0.15
356	0.16
357	0.16
358	0.16
359	0.16
360	0.2
361	0.23
362	0.24
363	0.24
364	0.24
365	0.26
366	0.25
367	0.23
368	0.19
369	0.15
370	0.14
371	0.13
372	0.13
373	0.15
374	0.15
375	0.16
376	0.17
377	0.16
378	0.17
379	0.2
380	0.24
381	0.29
382	0.37
383	0.43
384	0.45
385	0.47
386	0.49
387	0.57
388	0.55
389	0.48
390	0.42
391	0.37
392	0.33
393	0.32
394	0.28
395	0.17
396	0.19
397	0.22
398	0.22
399	0.23
400	0.24
401	0.23
402	0.3
403	0.33
404	0.33
405	0.4
406	0.48
407	0.55
408	0.63
409	0.7
410	0.73
411	0.79
412	0.84
413	0.84
414	0.84
415	0.84
416	0.82
417	0.83
418	0.78
419	0.78
420	0.77
421	0.72
422	0.64
423	0.56
424	0.5
425	0.41
426	0.37
427	0.3
428	0.21
429	0.17
430	0.14
431	0.14
432	0.16
433	0.17
434	0.17
435	0.16
436	0.17
437	0.2
438	0.22
439	0.22
440	0.19

A0A179GDC0

3D AlphaFold-predicted Structure Viewer