Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

I3EGI5

Protein Details
Accession I3EGI5    Localization Confidence High Confidence Score 18.4
NoLS Segment(s)
PositionSequenceProtein Nature
69-107LERINKIREKKQREREEWKKKFNRRTKKGQIPLGPRINYBasic
NLS Segment(s)
PositionSequence
45-47KEK
50-50K
53-97EIHKENLRKREERQKELERINKIREKKQREREEWKKKFNRRTKKG
Subcellular Location(s) nucl 23, cyto_nucl 13
Family & Domain DBs
InterPro View protein in InterPro  
IPR013730  Fyv7/TAP26  
Pfam View protein in Pfam  
PF08524  rRNA_processing  
Amino Acid Sequences MAWKSQRQYKKLKEEETVNRIRDESMKAALAEEKIEIKEEEAPKKEKTTKLDEIHKENLRKREERQKELERINKIREKKQREREEWKKKFNRRTKKGQIPLGPRINYLYQKIQDMKKNN
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.74
2 0.77
3 0.75
4 0.73
5 0.64
6 0.56
7 0.51
8 0.46
9 0.4
10 0.34
11 0.28
12 0.23
13 0.22
14 0.21
15 0.21
16 0.22
17 0.19
18 0.15
19 0.13
20 0.12
21 0.11
22 0.12
23 0.11
24 0.11
25 0.17
26 0.21
27 0.25
28 0.28
29 0.31
30 0.31
31 0.37
32 0.41
33 0.4
34 0.4
35 0.42
36 0.47
37 0.49
38 0.57
39 0.55
40 0.55
41 0.57
42 0.58
43 0.55
44 0.51
45 0.53
46 0.49
47 0.47
48 0.47
49 0.5
50 0.53
51 0.54
52 0.58
53 0.58
54 0.6
55 0.64
56 0.66
57 0.63
58 0.59
59 0.6
60 0.58
61 0.55
62 0.57
63 0.59
64 0.62
65 0.66
66 0.72
67 0.75
68 0.78
69 0.84
70 0.86
71 0.88
72 0.87
73 0.88
74 0.88
75 0.87
76 0.89
77 0.88
78 0.89
79 0.86
80 0.88
81 0.88
82 0.89
83 0.88
84 0.86
85 0.85
86 0.81
87 0.83
88 0.8
89 0.7
90 0.6
91 0.55
92 0.52
93 0.47
94 0.44
95 0.42
96 0.36
97 0.41
98 0.47
99 0.5