Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A179HTS5

Protein Details
Accession A0A179HTS5    Localization Confidence Medium Confidence Score 10.7
NoLS Segment(s)
PositionSequenceProtein Nature
66-86LKWYIPPRRRKGQPGVRRPVQHydrophilic
NLS Segment(s)
PositionSequence
73-83RRRKGQPGVRR
Subcellular Location(s) mito 19, nucl 7
Family & Domain DBs
InterPro View protein in InterPro  
IPR007918  MDM35_apoptosis  
KEGG plj:VFPFJ_02132  -  
Pfam View protein in Pfam  
PF05254  UPF0203  
Amino Acid Sequences MLQRFTESRLRSRIISSTYIILSQPFRLPSQLLTSSPASNAPPVTMSASLAPECNEVKERYDTCFLKWYIPPRRRKGQPGVRRPVQGIPKVSRCAERQGHRQAPR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.39
2 0.38
3 0.33
4 0.3
5 0.27
6 0.27
7 0.24
8 0.2
9 0.18
10 0.17
11 0.18
12 0.17
13 0.17
14 0.17
15 0.18
16 0.17
17 0.22
18 0.22
19 0.2
20 0.21
21 0.22
22 0.22
23 0.21
24 0.21
25 0.16
26 0.15
27 0.14
28 0.11
29 0.09
30 0.1
31 0.11
32 0.09
33 0.09
34 0.09
35 0.1
36 0.1
37 0.09
38 0.09
39 0.09
40 0.09
41 0.09
42 0.11
43 0.11
44 0.13
45 0.17
46 0.18
47 0.19
48 0.26
49 0.26
50 0.25
51 0.31
52 0.29
53 0.29
54 0.31
55 0.37
56 0.41
57 0.48
58 0.56
59 0.57
60 0.66
61 0.69
62 0.74
63 0.76
64 0.76
65 0.79
66 0.8
67 0.82
68 0.78
69 0.74
70 0.68
71 0.65
72 0.62
73 0.58
74 0.54
75 0.52
76 0.53
77 0.54
78 0.54
79 0.53
80 0.47
81 0.5
82 0.52
83 0.53
84 0.56
85 0.63