Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A179GGR2

Protein Details
Accession A0A179GGR2    Localization Confidence Medium Confidence Score 12.4
NoLS Segment(s)
PositionSequenceProtein Nature
21-40SSARIKKNKKANNVKFKVRCHydrophilic
NLS Segment(s)
PositionSequence
23-31ARIKKNKKA
Subcellular Location(s) nucl 15, cyto_nucl 10, mito 9
Family & Domain DBs
InterPro View protein in InterPro  
IPR002675  Ribosomal_L38e  
IPR038464  Ribosomal_L38e_sf  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
KEGG plj:VFPFJ_08335  -  
Pfam View protein in Pfam  
PF01781  Ribosomal_L38e  
Amino Acid Sequences MPKEVADIKKFIEICRRKDASSARIKKNKKANNVKFKVRCQKHLYTLVLKDTEKAEKLKQSLPPNLHIADVSSKKN
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.41
2 0.49
3 0.5
4 0.45
5 0.51
6 0.54
7 0.53
8 0.57
9 0.6
10 0.6
11 0.66
12 0.69
13 0.7
14 0.74
15 0.72
16 0.72
17 0.74
18 0.74
19 0.77
20 0.79
21 0.81
22 0.77
23 0.78
24 0.78
25 0.69
26 0.67
27 0.62
28 0.61
29 0.58
30 0.59
31 0.55
32 0.49
33 0.48
34 0.44
35 0.4
36 0.34
37 0.29
38 0.25
39 0.25
40 0.22
41 0.23
42 0.24
43 0.27
44 0.3
45 0.34
46 0.39
47 0.43
48 0.49
49 0.49
50 0.5
51 0.49
52 0.46
53 0.42
54 0.34
55 0.29
56 0.3