Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

I3EHR1

Protein Details
Accession I3EHR1   
Localization Confidence Medium
Confidence Score 12.6
NoLS Segment(s)
PositionSequenceProtein Nature
26-46NLEGRKHKRKREEQLNTPQKMBasic
NLS Segment(s)
PositionSequence
31-35KHKRK
Subcellular Location(s) mito 14, nucl 12
Family & Domain DBs
Amino Acid Sequences MRYKTKALITLSIIVQLINSTADQINLEGRKHKRKREEQLNTPQKMQQTMLEPNNIECSALNTYQPHPSTH
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.21
2 0.17
3 0.13
4 0.1
5 0.07
6 0.07
7 0.07
8 0.07
9 0.07
10 0.07
11 0.08
12 0.12
13 0.13
14 0.14
15 0.19
16 0.25
17 0.36
18 0.42
19 0.48
20 0.54
21 0.62
22 0.71
23 0.75
24 0.78
25 0.77
26 0.82
27 0.84
28 0.76
29 0.68
30 0.6
31 0.51
32 0.44
33 0.36
34 0.28
35 0.23
36 0.28
37 0.29
38 0.3
39 0.29
40 0.28
41 0.32
42 0.28
43 0.24
44 0.16
45 0.18
46 0.19
47 0.19
48 0.21
49 0.19
50 0.22
51 0.29