Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A179HZY8

Protein Details
Accession A0A179HZY8    Localization Confidence Low Confidence Score 7
NoLS Segment(s)
PositionSequenceProtein Nature
15-41LLWKIPWRLSRFQKRRHRLRLRAVDSVHydrophilic
75-98RDKYTMFDRKAKKYRKGIHMDESFHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 22.5, cyto_mito 13, cyto 2.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR016340  Ribosomal_L31_mit  
Gene Ontology GO:0005840  C:ribosome  
KEGG plj:VFPFJ_01230  -  
Pfam View protein in Pfam  
PF09784  L31  
Amino Acid Sequences MFGPFRITNPLSGGLLWKIPWRLSRFQKRRHRLRLRAVDSVVATLDAALAKKGQTLEALERWKAEMPTEAEMLPRDKYTMFDRKAKKYRKGIHMDESFAEG
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.17
2 0.17
3 0.16
4 0.17
5 0.17
6 0.19
7 0.25
8 0.28
9 0.36
10 0.45
11 0.55
12 0.61
13 0.69
14 0.78
15 0.82
16 0.87
17 0.9
18 0.9
19 0.88
20 0.89
21 0.9
22 0.84
23 0.79
24 0.69
25 0.6
26 0.49
27 0.4
28 0.29
29 0.18
30 0.12
31 0.07
32 0.06
33 0.04
34 0.04
35 0.04
36 0.04
37 0.04
38 0.05
39 0.06
40 0.06
41 0.06
42 0.08
43 0.11
44 0.15
45 0.18
46 0.17
47 0.17
48 0.18
49 0.19
50 0.18
51 0.16
52 0.15
53 0.15
54 0.17
55 0.18
56 0.17
57 0.16
58 0.17
59 0.19
60 0.15
61 0.13
62 0.12
63 0.11
64 0.14
65 0.2
66 0.28
67 0.31
68 0.38
69 0.46
70 0.55
71 0.65
72 0.71
73 0.74
74 0.75
75 0.81
76 0.82
77 0.84
78 0.81
79 0.81
80 0.76
81 0.7