Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

I3EG96

Protein Details
Accession I3EG96   
Localization Confidence Low
Confidence Score 9.5
NoLS Segment(s)
PositionSequenceProtein Nature
227-246LAIKRDPRVNKENKAKPKQEHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 18.5, cyto_nucl 14, cyto 8.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR001623  DnaJ_domain  
IPR018253  DnaJ_domain_CS  
IPR036869  J_dom_sf  
IPR044634  Zuotin/DnaJC2  
Gene Ontology GO:0030544  F:Hsp70 protein binding  
GO:0043022  F:ribosome binding  
GO:0051083  P:'de novo' cotranslational protein folding  
GO:0006450  P:regulation of translational fidelity  
Pfam View protein in Pfam  
PF00226  DnaJ  
PROSITE View protein in PROSITE  
PS00636  DNAJ_1  
PS50076  DNAJ_2  
Amino Acid Sequences MKVTHYYGPTGLSERKPVQAKTVEKMKTPRDLFEKYTIEDIKDWKTLDLYYLMGFTQEEANEYTEANFKDAFKRQAKLFHPDRLLSCKIDDGGASFIALTKAHEVLSNPHKKKLYDFIAFDETIPEDRDYTDEEFFAVFDEAFTRNSVFSVKPYTVSLGDLSSKDSAIVAFYKFWQNFESIRAFEFLCKDEDYQSREMRRQAAVENKQLLNEKKAEDNQRIRKLVTLAIKRDPRVNKENKAKPKQEITVDSDGWKNTEVEALTKIATKTPPRTRNRIDVIFSALSRFAPTRSKKDVQAKLLKVDASIQKLSKKK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.36
2 0.42
3 0.46
4 0.45
5 0.47
6 0.5
7 0.52
8 0.51
9 0.58
10 0.54
11 0.53
12 0.6
13 0.58
14 0.59
15 0.57
16 0.56
17 0.54
18 0.56
19 0.54
20 0.55
21 0.53
22 0.45
23 0.5
24 0.45
25 0.4
26 0.37
27 0.36
28 0.32
29 0.32
30 0.31
31 0.24
32 0.24
33 0.22
34 0.22
35 0.19
36 0.16
37 0.13
38 0.13
39 0.12
40 0.11
41 0.1
42 0.09
43 0.1
44 0.09
45 0.11
46 0.11
47 0.13
48 0.13
49 0.14
50 0.14
51 0.16
52 0.16
53 0.16
54 0.16
55 0.16
56 0.22
57 0.27
58 0.35
59 0.34
60 0.38
61 0.39
62 0.46
63 0.49
64 0.52
65 0.51
66 0.5
67 0.5
68 0.49
69 0.49
70 0.47
71 0.46
72 0.38
73 0.33
74 0.27
75 0.24
76 0.21
77 0.18
78 0.13
79 0.12
80 0.1
81 0.09
82 0.08
83 0.08
84 0.08
85 0.08
86 0.07
87 0.07
88 0.08
89 0.08
90 0.1
91 0.1
92 0.15
93 0.25
94 0.35
95 0.35
96 0.4
97 0.42
98 0.42
99 0.44
100 0.47
101 0.44
102 0.4
103 0.39
104 0.38
105 0.39
106 0.39
107 0.35
108 0.27
109 0.2
110 0.16
111 0.16
112 0.13
113 0.09
114 0.09
115 0.1
116 0.11
117 0.13
118 0.13
119 0.11
120 0.11
121 0.11
122 0.1
123 0.1
124 0.08
125 0.05
126 0.05
127 0.06
128 0.07
129 0.07
130 0.08
131 0.07
132 0.07
133 0.08
134 0.09
135 0.08
136 0.09
137 0.12
138 0.12
139 0.12
140 0.12
141 0.14
142 0.12
143 0.13
144 0.12
145 0.09
146 0.1
147 0.09
148 0.11
149 0.09
150 0.09
151 0.08
152 0.08
153 0.07
154 0.06
155 0.07
156 0.06
157 0.06
158 0.08
159 0.14
160 0.14
161 0.15
162 0.15
163 0.16
164 0.16
165 0.19
166 0.2
167 0.15
168 0.15
169 0.16
170 0.15
171 0.14
172 0.15
173 0.13
174 0.13
175 0.13
176 0.13
177 0.16
178 0.2
179 0.23
180 0.26
181 0.29
182 0.31
183 0.33
184 0.35
185 0.34
186 0.32
187 0.29
188 0.29
189 0.35
190 0.36
191 0.39
192 0.41
193 0.38
194 0.39
195 0.42
196 0.39
197 0.33
198 0.31
199 0.27
200 0.27
201 0.33
202 0.37
203 0.41
204 0.49
205 0.54
206 0.6
207 0.6
208 0.56
209 0.52
210 0.48
211 0.44
212 0.43
213 0.4
214 0.36
215 0.43
216 0.47
217 0.45
218 0.51
219 0.51
220 0.5
221 0.53
222 0.57
223 0.59
224 0.65
225 0.73
226 0.77
227 0.81
228 0.79
229 0.76
230 0.75
231 0.71
232 0.67
233 0.63
234 0.59
235 0.56
236 0.51
237 0.47
238 0.42
239 0.36
240 0.31
241 0.26
242 0.19
243 0.13
244 0.16
245 0.14
246 0.13
247 0.15
248 0.15
249 0.14
250 0.17
251 0.17
252 0.17
253 0.23
254 0.27
255 0.35
256 0.45
257 0.54
258 0.59
259 0.68
260 0.71
261 0.75
262 0.77
263 0.74
264 0.67
265 0.59
266 0.59
267 0.51
268 0.45
269 0.37
270 0.29
271 0.23
272 0.22
273 0.2
274 0.17
275 0.24
276 0.3
277 0.37
278 0.45
279 0.49
280 0.56
281 0.65
282 0.71
283 0.72
284 0.75
285 0.71
286 0.68
287 0.67
288 0.58
289 0.48
290 0.47
291 0.43
292 0.39
293 0.39
294 0.37