Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A179HKE3

Protein Details
Accession A0A179HKE3    Localization Confidence Low Confidence Score 5.8
NoLS Segment(s)
PositionSequenceProtein Nature
143-168VYGTPACAHRPRRRSRWRAGLQAKFTHydrophilic
NLS Segment(s)
Subcellular Location(s) cyto 7.5, plas 7, cyto_nucl 5.5, mito 4, nucl 2.5, extr 2, pero 2
Family & Domain DBs
InterPro View protein in InterPro  
IPR001810  F-box_dom  
Gene Ontology GO:0016020  C:membrane  
KEGG plj:VFPFJ_06434  -  
PROSITE View protein in PROSITE  
PS50181  FBOX  
Amino Acid Sequences MTTTTDTAPAVLRCRRPTIPESAPGLPSTGGSDSVCDRPPVAQLDLLSLPPELHLAVSEYLIYPDALSLKHTNRHFYSIVDTGIELKIDWLMERRRLHLECPNDRRCDLGSDLRFCRGSVPLLMRRRREHVECESRPGLGCLVYGTPACAHRPRRRSRWRAGLQAKFTVELWWLLLLALVPVLCACILAARWVEN
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.43
2 0.45
3 0.48
4 0.49
5 0.52
6 0.5
7 0.5
8 0.52
9 0.48
10 0.47
11 0.41
12 0.38
13 0.29
14 0.24
15 0.19
16 0.14
17 0.13
18 0.11
19 0.13
20 0.14
21 0.18
22 0.19
23 0.17
24 0.16
25 0.15
26 0.19
27 0.21
28 0.2
29 0.18
30 0.17
31 0.2
32 0.21
33 0.2
34 0.17
35 0.13
36 0.12
37 0.1
38 0.1
39 0.06
40 0.05
41 0.06
42 0.07
43 0.07
44 0.07
45 0.07
46 0.07
47 0.07
48 0.08
49 0.07
50 0.05
51 0.05
52 0.06
53 0.06
54 0.09
55 0.12
56 0.14
57 0.21
58 0.22
59 0.27
60 0.28
61 0.32
62 0.3
63 0.27
64 0.29
65 0.24
66 0.23
67 0.18
68 0.16
69 0.13
70 0.13
71 0.12
72 0.07
73 0.05
74 0.06
75 0.05
76 0.06
77 0.08
78 0.11
79 0.17
80 0.18
81 0.21
82 0.25
83 0.26
84 0.29
85 0.3
86 0.36
87 0.38
88 0.46
89 0.49
90 0.46
91 0.45
92 0.44
93 0.39
94 0.34
95 0.29
96 0.28
97 0.26
98 0.29
99 0.3
100 0.31
101 0.3
102 0.27
103 0.25
104 0.19
105 0.17
106 0.15
107 0.2
108 0.26
109 0.34
110 0.39
111 0.43
112 0.45
113 0.49
114 0.51
115 0.49
116 0.48
117 0.49
118 0.54
119 0.5
120 0.54
121 0.5
122 0.45
123 0.41
124 0.36
125 0.26
126 0.16
127 0.15
128 0.08
129 0.08
130 0.09
131 0.08
132 0.08
133 0.09
134 0.11
135 0.14
136 0.21
137 0.29
138 0.37
139 0.47
140 0.56
141 0.65
142 0.75
143 0.8
144 0.83
145 0.85
146 0.84
147 0.85
148 0.86
149 0.83
150 0.77
151 0.73
152 0.64
153 0.55
154 0.47
155 0.37
156 0.29
157 0.21
158 0.17
159 0.11
160 0.1
161 0.09
162 0.09
163 0.07
164 0.06
165 0.06
166 0.05
167 0.05
168 0.04
169 0.05
170 0.05
171 0.05
172 0.05
173 0.06
174 0.07
175 0.1