Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

I3EFG2

Protein Details
Accession I3EFG2    Localization Confidence Medium Confidence Score 10.1
NoLS Segment(s)
PositionSequenceProtein Nature
1-23MTKKRRNNGRSKMNRGHTRSIRCHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 19, mito_nucl 13, mito 5
Family & Domain DBs
InterPro View protein in InterPro  
IPR000892  Ribosomal_S26e  
IPR038551  Ribosomal_S26e_sf  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF01283  Ribosomal_S26e  
Amino Acid Sequences MTKKRRNNGRSKMNRGHTRSIRCENCYRSCPKDKAIKRFHIKNVIDNASFDDIKLASVYEDFEVPKFYYKLEYCISCAVHQRIVRARSVEGRKDRTNPFMKRRMNLLNASA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.89
2 0.84
3 0.84
4 0.81
5 0.79
6 0.77
7 0.77
8 0.72
9 0.68
10 0.69
11 0.66
12 0.64
13 0.62
14 0.6
15 0.57
16 0.61
17 0.59
18 0.57
19 0.61
20 0.62
21 0.66
22 0.69
23 0.71
24 0.7
25 0.74
26 0.74
27 0.74
28 0.67
29 0.62
30 0.6
31 0.54
32 0.46
33 0.39
34 0.35
35 0.27
36 0.26
37 0.2
38 0.14
39 0.1
40 0.1
41 0.09
42 0.07
43 0.04
44 0.05
45 0.05
46 0.05
47 0.06
48 0.06
49 0.06
50 0.08
51 0.08
52 0.11
53 0.11
54 0.11
55 0.16
56 0.16
57 0.2
58 0.21
59 0.22
60 0.2
61 0.24
62 0.25
63 0.21
64 0.27
65 0.25
66 0.28
67 0.28
68 0.31
69 0.35
70 0.36
71 0.37
72 0.33
73 0.33
74 0.36
75 0.42
76 0.46
77 0.47
78 0.52
79 0.54
80 0.59
81 0.61
82 0.62
83 0.65
84 0.65
85 0.66
86 0.69
87 0.71
88 0.67
89 0.7
90 0.69
91 0.66