Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A179HL93

Protein Details
Accession A0A179HL93    Localization Confidence Medium Confidence Score 10
NoLS Segment(s)
PositionSequenceProtein Nature
49-89APKAAPKPAPKKAPKQDPKKSPKQDPKKSPKQDPKAAPKPABasic
NLS Segment(s)
PositionSequence
42-117PPANANAAPKAAPKPAPKKAPKQDPKKSPKQDPKKSPKQDPKAAPKPAPKKGAPAPKKGQPAPKKGKPAPKAAPKP
199-229GKAPGPKGGAPAPATGKAPAGKPAGGPSAPK
Subcellular Location(s) extr 22, E.R. 3
Family & Domain DBs
KEGG plj:VFPFJ_04389  -  
Amino Acid Sequences MKTSLVYLAALVLSAIAVPVEHSEAGLNPELPAVDSKAAKAPPANANAAPKAAPKPAPKKAPKQDPKKSPKQDPKKSPKQDPKAAPKPAPKKGAPAPKKGQPAPKKGKPAPKAAPKPNAAAPNATAPLPLGPETCAGMGKSCAHVYNKFKDALDNGTIDLEMIDEFAAKLERDPKCADAVQDCGGKLPQGVLPAPASAGKAPGPKGGAPAPATGKAPAGKPAGGPSAPKV
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.04
2 0.04
3 0.03
4 0.03
5 0.03
6 0.05
7 0.07
8 0.07
9 0.07
10 0.08
11 0.09
12 0.12
13 0.14
14 0.13
15 0.11
16 0.12
17 0.11
18 0.12
19 0.12
20 0.11
21 0.13
22 0.13
23 0.14
24 0.19
25 0.2
26 0.21
27 0.21
28 0.24
29 0.27
30 0.3
31 0.32
32 0.29
33 0.33
34 0.32
35 0.32
36 0.27
37 0.24
38 0.23
39 0.24
40 0.27
41 0.32
42 0.4
43 0.47
44 0.56
45 0.61
46 0.68
47 0.74
48 0.79
49 0.81
50 0.83
51 0.85
52 0.85
53 0.87
54 0.88
55 0.86
56 0.86
57 0.87
58 0.87
59 0.88
60 0.88
61 0.89
62 0.9
63 0.9
64 0.9
65 0.89
66 0.87
67 0.86
68 0.84
69 0.84
70 0.82
71 0.79
72 0.75
73 0.73
74 0.72
75 0.7
76 0.68
77 0.58
78 0.55
79 0.56
80 0.61
81 0.57
82 0.57
83 0.55
84 0.55
85 0.61
86 0.58
87 0.61
88 0.58
89 0.63
90 0.64
91 0.65
92 0.68
93 0.67
94 0.72
95 0.67
96 0.68
97 0.65
98 0.66
99 0.69
100 0.66
101 0.68
102 0.6
103 0.58
104 0.54
105 0.49
106 0.4
107 0.32
108 0.26
109 0.22
110 0.21
111 0.18
112 0.13
113 0.09
114 0.09
115 0.09
116 0.09
117 0.06
118 0.06
119 0.07
120 0.08
121 0.08
122 0.08
123 0.07
124 0.07
125 0.09
126 0.09
127 0.1
128 0.1
129 0.13
130 0.15
131 0.21
132 0.25
133 0.29
134 0.32
135 0.31
136 0.31
137 0.3
138 0.29
139 0.27
140 0.24
141 0.19
142 0.16
143 0.15
144 0.15
145 0.13
146 0.11
147 0.07
148 0.04
149 0.04
150 0.04
151 0.03
152 0.04
153 0.04
154 0.06
155 0.05
156 0.07
157 0.15
158 0.16
159 0.2
160 0.23
161 0.23
162 0.26
163 0.28
164 0.28
165 0.22
166 0.25
167 0.25
168 0.25
169 0.24
170 0.21
171 0.21
172 0.19
173 0.16
174 0.14
175 0.12
176 0.13
177 0.13
178 0.14
179 0.14
180 0.14
181 0.15
182 0.14
183 0.14
184 0.11
185 0.13
186 0.14
187 0.17
188 0.18
189 0.21
190 0.23
191 0.22
192 0.26
193 0.27
194 0.29
195 0.26
196 0.29
197 0.3
198 0.29
199 0.3
200 0.27
201 0.28
202 0.25
203 0.25
204 0.27
205 0.26
206 0.25
207 0.24
208 0.28
209 0.3
210 0.29