Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A179GNZ7

Protein Details
Accession A0A179GNZ7    Localization Confidence Low Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
30-49DASWRKPKGIDNRVRRRFRGBasic
NLS Segment(s)
Subcellular Location(s) mito 17.5, mito_nucl 10.5, cyto 7
Family & Domain DBs
InterPro View protein in InterPro  
IPR001515  Ribosomal_L32e  
IPR018263  Ribosomal_L32e_CS  
IPR036351  Ribosomal_L32e_sf  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
KEGG plj:VFPFJ_02376  -  
Pfam View protein in Pfam  
PF01655  Ribosomal_L32e  
PROSITE View protein in PROSITE  
PS00580  RIBOSOMAL_L32E  
CDD cd00513  Ribosomal_L32_L32e  
Amino Acid Sequences MVSAKKHVPIVKKRTTRFFRHQSDRFMRLDASWRKPKGIDNRVRRRFRGTQAMPSIGYGSNKKTRFMMPSGHKAFLVSNVKDVELLMMHNRTYAAEIASNVSSRKRIDIIARAKQLGVKVTNAKAKVTTEV
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.76
2 0.79
3 0.78
4 0.78
5 0.79
6 0.79
7 0.8
8 0.8
9 0.79
10 0.79
11 0.75
12 0.66
13 0.57
14 0.48
15 0.39
16 0.43
17 0.4
18 0.41
19 0.45
20 0.45
21 0.45
22 0.46
23 0.52
24 0.53
25 0.56
26 0.57
27 0.59
28 0.69
29 0.77
30 0.81
31 0.75
32 0.73
33 0.69
34 0.65
35 0.65
36 0.57
37 0.55
38 0.54
39 0.53
40 0.45
41 0.39
42 0.34
43 0.24
44 0.23
45 0.16
46 0.16
47 0.22
48 0.22
49 0.23
50 0.23
51 0.24
52 0.26
53 0.26
54 0.3
55 0.28
56 0.37
57 0.39
58 0.38
59 0.36
60 0.33
61 0.31
62 0.3
63 0.31
64 0.22
65 0.22
66 0.22
67 0.22
68 0.21
69 0.21
70 0.14
71 0.08
72 0.09
73 0.08
74 0.09
75 0.09
76 0.09
77 0.1
78 0.09
79 0.1
80 0.1
81 0.09
82 0.09
83 0.09
84 0.12
85 0.12
86 0.13
87 0.13
88 0.14
89 0.16
90 0.16
91 0.18
92 0.17
93 0.2
94 0.25
95 0.33
96 0.4
97 0.46
98 0.49
99 0.47
100 0.46
101 0.45
102 0.42
103 0.38
104 0.32
105 0.28
106 0.31
107 0.36
108 0.42
109 0.41
110 0.4
111 0.37