Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A179HRF3

Protein Details
Accession A0A179HRF3    Localization Confidence Medium Confidence Score 13.9
NoLS Segment(s)
PositionSequenceProtein Nature
1-27MVKKRKNNGRNKKGRGHVKPIRCSNCSHydrophilic
81-112GKIVRVRSRVGRRNRAPPPRVRYNKDGKKITPBasic
NLS Segment(s)
PositionSequence
3-19KKRKNNGRNKKGRGHVK
85-109RVRSRVGRRNRAPPPRVRYNKDGKK
Subcellular Location(s) mito 14.5, mito_nucl 11.5, nucl 7.5, cyto 5
Family & Domain DBs
InterPro View protein in InterPro  
IPR000892  Ribosomal_S26e  
IPR038551  Ribosomal_S26e_sf  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
KEGG plj:VFPFJ_02068  -  
Pfam View protein in Pfam  
PF01283  Ribosomal_S26e  
PROSITE View protein in PROSITE  
PS00733  RIBOSOMAL_S26E  
Amino Acid Sequences MVKKRKNNGRNKKGRGHVKPIRCSNCSRCTPKDKAIKRFTIRNMVESAAIRDISDASVFSEYTVPKMYLKLQYCVSCAIHGKIVRVRSRVGRRNRAPPPRVRYNKDGKKITPTVAKA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.89
2 0.86
3 0.85
4 0.83
5 0.82
6 0.83
7 0.83
8 0.8
9 0.73
10 0.72
11 0.69
12 0.69
13 0.68
14 0.66
15 0.63
16 0.64
17 0.68
18 0.69
19 0.71
20 0.7
21 0.72
22 0.73
23 0.75
24 0.71
25 0.72
26 0.67
27 0.67
28 0.59
29 0.51
30 0.45
31 0.36
32 0.34
33 0.27
34 0.24
35 0.15
36 0.14
37 0.11
38 0.1
39 0.09
40 0.08
41 0.07
42 0.06
43 0.05
44 0.06
45 0.06
46 0.06
47 0.08
48 0.08
49 0.09
50 0.1
51 0.1
52 0.09
53 0.11
54 0.13
55 0.18
56 0.2
57 0.22
58 0.24
59 0.25
60 0.26
61 0.28
62 0.25
63 0.2
64 0.2
65 0.19
66 0.2
67 0.2
68 0.22
69 0.23
70 0.29
71 0.32
72 0.32
73 0.34
74 0.38
75 0.48
76 0.53
77 0.6
78 0.64
79 0.66
80 0.74
81 0.81
82 0.82
83 0.79
84 0.8
85 0.79
86 0.79
87 0.82
88 0.79
89 0.78
90 0.78
91 0.81
92 0.81
93 0.8
94 0.72
95 0.73
96 0.7
97 0.68