Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A179GDD9

Protein Details
Accession A0A179GDD9    Localization Confidence Medium Confidence Score 10.5
NoLS Segment(s)
PositionSequenceProtein Nature
101-127FLYRMKTKTGRRILLRRRLKGRRNVAWHydrophilic
NLS Segment(s)
PositionSequence
98-124RHGFLYRMKTKTGRRILLRRRLKGRRN
Subcellular Location(s) mito 18, nucl 7.5, cyto_nucl 4.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR000271  Ribosomal_L34  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
KEGG plj:VFPFJ_10826  -  
Pfam View protein in Pfam  
PF00468  Ribosomal_L34  
Amino Acid Sequences MQSLTRLARPLLSKPLSSARTFTTLSPLRPSLTPLRRPSAFTSFTPAPTPATSTGAAIADVVPTGAVSSHPSLAGALQMRFGPRNTMNGHTRLVQKRRHGFLYRMKTKTGRRILLRRRLKGRRNVAW
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.35
2 0.43
3 0.41
4 0.4
5 0.37
6 0.31
7 0.32
8 0.33
9 0.3
10 0.3
11 0.31
12 0.31
13 0.34
14 0.32
15 0.29
16 0.29
17 0.33
18 0.34
19 0.38
20 0.44
21 0.44
22 0.49
23 0.48
24 0.51
25 0.52
26 0.49
27 0.44
28 0.36
29 0.39
30 0.34
31 0.34
32 0.32
33 0.28
34 0.22
35 0.19
36 0.21
37 0.15
38 0.16
39 0.15
40 0.14
41 0.14
42 0.12
43 0.11
44 0.09
45 0.08
46 0.05
47 0.04
48 0.04
49 0.03
50 0.02
51 0.02
52 0.02
53 0.03
54 0.05
55 0.06
56 0.06
57 0.06
58 0.06
59 0.07
60 0.07
61 0.09
62 0.09
63 0.08
64 0.08
65 0.09
66 0.11
67 0.12
68 0.12
69 0.15
70 0.14
71 0.19
72 0.21
73 0.26
74 0.29
75 0.3
76 0.32
77 0.3
78 0.38
79 0.41
80 0.46
81 0.47
82 0.53
83 0.58
84 0.62
85 0.65
86 0.61
87 0.6
88 0.63
89 0.67
90 0.67
91 0.61
92 0.61
93 0.61
94 0.64
95 0.67
96 0.67
97 0.64
98 0.63
99 0.72
100 0.78
101 0.81
102 0.84
103 0.83
104 0.84
105 0.86
106 0.87
107 0.86