Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A179I113

Protein Details
Accession A0A179I113   
Localization Confidence Medium
Confidence Score 14.4
NoLS Segment(s)
PositionSequenceProtein Nature
71-92RVSSRWKKLTSSCKAKRSKRTSHydrophilic
NLS Segment(s)
PositionSequence
84-90KAKRSKR
Subcellular Location(s) nucl 16, mito 6, cyto 3
Family & Domain DBs
KEGG plj:VFPFJ_01430  -  
Amino Acid Sequences MLTCTTNFQVTCAPLEYPGLAATVPTSLDAAVEPPPPTPGLRRCYSVERQRRPTLRLRSRNNGTWNRSVRRVSSRWKKLTSSCKAKRSKRTS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.17
2 0.18
3 0.16
4 0.13
5 0.12
6 0.1
7 0.08
8 0.07
9 0.07
10 0.06
11 0.06
12 0.05
13 0.05
14 0.05
15 0.05
16 0.05
17 0.06
18 0.07
19 0.09
20 0.09
21 0.09
22 0.1
23 0.11
24 0.12
25 0.16
26 0.2
27 0.24
28 0.25
29 0.28
30 0.3
31 0.35
32 0.42
33 0.47
34 0.51
35 0.53
36 0.59
37 0.63
38 0.64
39 0.63
40 0.64
41 0.65
42 0.66
43 0.68
44 0.68
45 0.7
46 0.72
47 0.74
48 0.74
49 0.72
50 0.67
51 0.66
52 0.66
53 0.61
54 0.61
55 0.57
56 0.53
57 0.53
58 0.53
59 0.54
60 0.58
61 0.64
62 0.66
63 0.68
64 0.69
65 0.69
66 0.75
67 0.74
68 0.75
69 0.73
70 0.75
71 0.81
72 0.85