Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A179HPU6

Protein Details
Accession A0A179HPU6    Localization Confidence Medium Confidence Score 10
NoLS Segment(s)
PositionSequenceProtein Nature
19-38RIAHGKRKEGKRRTQGSRQEBasic
NLS Segment(s)
PositionSequence
19-31RIAHGKRKEGKRR
Subcellular Location(s) mito 17, nucl 6.5, cyto_nucl 5.5, cyto 3.5
Family & Domain DBs
KEGG plj:VFPFJ_03438  -  
Amino Acid Sequences MAWSGVGRSHRSRTSHTLRIAHGKRKEGKRRTQGSRQETTGVRPSVHHLDARPSPTTTATPTTRRSCHAHLAHPS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.56
2 0.58
3 0.59
4 0.57
5 0.54
6 0.61
7 0.61
8 0.6
9 0.57
10 0.57
11 0.59
12 0.65
13 0.73
14 0.71
15 0.75
16 0.76
17 0.8
18 0.8
19 0.81
20 0.8
21 0.76
22 0.71
23 0.63
24 0.57
25 0.48
26 0.44
27 0.41
28 0.32
29 0.25
30 0.22
31 0.25
32 0.26
33 0.27
34 0.25
35 0.19
36 0.24
37 0.27
38 0.3
39 0.28
40 0.24
41 0.24
42 0.25
43 0.25
44 0.23
45 0.26
46 0.27
47 0.3
48 0.37
49 0.43
50 0.44
51 0.47
52 0.5
53 0.48
54 0.54
55 0.54