Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

I3EGA6

Protein Details
Accession I3EGA6   
Localization Confidence Low
Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
43-62FSPTSKKPVHRKPYVNMTRRHydrophilic
NLS Segment(s)
Subcellular Location(s) plas 14, mito 5, E.R. 4, extr 2, golg 2
Family & Domain DBs
Amino Acid Sequences MKLLSVLIILIILINIALGYTVMVISYEAIFKKTMFSAVVKYFSPTSKKPVHRKPYVNMTRRKSGLDSSY
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.02
2 0.02
3 0.02
4 0.02
5 0.02
6 0.02
7 0.02
8 0.03
9 0.03
10 0.03
11 0.03
12 0.04
13 0.04
14 0.06
15 0.06
16 0.07
17 0.08
18 0.08
19 0.09
20 0.08
21 0.09
22 0.09
23 0.1
24 0.12
25 0.14
26 0.16
27 0.15
28 0.16
29 0.17
30 0.19
31 0.23
32 0.21
33 0.26
34 0.33
35 0.42
36 0.51
37 0.6
38 0.67
39 0.72
40 0.77
41 0.77
42 0.79
43 0.8
44 0.79
45 0.78
46 0.75
47 0.74
48 0.7
49 0.66
50 0.58