Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A179HPQ8

Protein Details
Accession A0A179HPQ8   
Localization Confidence Medium
Confidence Score 11.6
NoLS Segment(s)
PositionSequenceProtein Nature
439-480DEKAREAKDKERWARLRKVKSLFETKGARKLRRPLSRPGTSHBasic
NLS Segment(s)
PositionSequence
443-477REAKDKERWARLRKVKSLFETKGARKLRRPLSRPG
Subcellular Location(s) nucl 12.5, mito 10, cyto_nucl 8.5, cyto 3.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR013909  NIPA/Rsm1_C  
IPR012935  Znf_C3HC-like  
Gene Ontology GO:0005634  C:nucleus  
GO:0008270  F:zinc ion binding  
KEGG plj:VFPFJ_04165  -  
Pfam View protein in Pfam  
PF08600  Rsm1  
PF07967  zf-C3HC  
Amino Acid Sequences MHATKRKFNALLQGLSNPRPSSTSDATASGTMDADSRRGDAAAAAASHDALLQKRRRLGFPDSTAPSAYNPSLASSISSALRRSTTQASAKSVKDKDALAKYAPGDRDELLKRLATFQELTDWTPKPERVSEIEWAKRGWICQGKERVRCVLCHKELVVKLNRKDVDGKEVPVLVASEIEEALVEKYTELIVSSHQQDCLWRRRGCEDSLLRLSFSNTQSTLSALRNRYDELCSRSSFLPYEFNLRLPDGINLDGVLAELPTDFFANAKSLEEPSKPVNRPALALALMGWQGLSNSRIGAVPNSASCHTCLRRLGLWMFKSKEVDDDGQVIVPAPMDFLDPVREHRFFCPWSNAKAQSRGASSKESADNAGWNMLLQTIENDSELRDVYEGRSKRFGRLIHDHEAPPSTPGRDASTPAPATPGEPATPGANNPQDEEVDEKAREAKDKERWARLRKVKSLFETKGARKLRRPLSRPGTSHSNKSGA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.48
2 0.48
3 0.5
4 0.4
5 0.35
6 0.32
7 0.33
8 0.33
9 0.33
10 0.35
11 0.32
12 0.33
13 0.34
14 0.33
15 0.3
16 0.23
17 0.18
18 0.13
19 0.14
20 0.12
21 0.13
22 0.13
23 0.13
24 0.13
25 0.13
26 0.13
27 0.11
28 0.12
29 0.12
30 0.11
31 0.11
32 0.1
33 0.1
34 0.1
35 0.1
36 0.11
37 0.12
38 0.21
39 0.26
40 0.32
41 0.39
42 0.42
43 0.46
44 0.49
45 0.54
46 0.55
47 0.55
48 0.58
49 0.55
50 0.53
51 0.5
52 0.45
53 0.38
54 0.33
55 0.27
56 0.2
57 0.17
58 0.16
59 0.17
60 0.16
61 0.16
62 0.12
63 0.15
64 0.16
65 0.17
66 0.16
67 0.17
68 0.19
69 0.19
70 0.23
71 0.25
72 0.29
73 0.33
74 0.36
75 0.41
76 0.45
77 0.47
78 0.51
79 0.48
80 0.44
81 0.4
82 0.39
83 0.4
84 0.4
85 0.4
86 0.33
87 0.35
88 0.33
89 0.36
90 0.35
91 0.28
92 0.24
93 0.22
94 0.28
95 0.26
96 0.27
97 0.23
98 0.24
99 0.23
100 0.25
101 0.25
102 0.21
103 0.2
104 0.18
105 0.22
106 0.21
107 0.23
108 0.25
109 0.25
110 0.25
111 0.28
112 0.3
113 0.26
114 0.28
115 0.29
116 0.28
117 0.31
118 0.35
119 0.39
120 0.41
121 0.4
122 0.37
123 0.36
124 0.32
125 0.29
126 0.3
127 0.29
128 0.28
129 0.34
130 0.44
131 0.5
132 0.55
133 0.57
134 0.57
135 0.51
136 0.52
137 0.52
138 0.52
139 0.46
140 0.43
141 0.41
142 0.39
143 0.4
144 0.44
145 0.45
146 0.43
147 0.43
148 0.48
149 0.47
150 0.43
151 0.46
152 0.4
153 0.4
154 0.35
155 0.34
156 0.28
157 0.28
158 0.26
159 0.2
160 0.19
161 0.1
162 0.08
163 0.07
164 0.06
165 0.05
166 0.05
167 0.04
168 0.05
169 0.05
170 0.05
171 0.05
172 0.04
173 0.05
174 0.05
175 0.05
176 0.05
177 0.05
178 0.06
179 0.09
180 0.12
181 0.13
182 0.13
183 0.14
184 0.17
185 0.23
186 0.3
187 0.36
188 0.35
189 0.36
190 0.4
191 0.44
192 0.41
193 0.44
194 0.38
195 0.36
196 0.39
197 0.37
198 0.33
199 0.29
200 0.3
201 0.26
202 0.25
203 0.2
204 0.16
205 0.16
206 0.16
207 0.17
208 0.18
209 0.15
210 0.2
211 0.19
212 0.2
213 0.2
214 0.21
215 0.22
216 0.22
217 0.23
218 0.22
219 0.23
220 0.22
221 0.24
222 0.23
223 0.23
224 0.21
225 0.18
226 0.17
227 0.14
228 0.2
229 0.18
230 0.19
231 0.19
232 0.18
233 0.18
234 0.15
235 0.15
236 0.1
237 0.1
238 0.09
239 0.08
240 0.07
241 0.06
242 0.06
243 0.04
244 0.03
245 0.03
246 0.03
247 0.03
248 0.03
249 0.03
250 0.03
251 0.03
252 0.04
253 0.05
254 0.06
255 0.07
256 0.07
257 0.09
258 0.11
259 0.12
260 0.13
261 0.17
262 0.25
263 0.25
264 0.27
265 0.3
266 0.28
267 0.29
268 0.28
269 0.25
270 0.17
271 0.16
272 0.13
273 0.1
274 0.09
275 0.08
276 0.07
277 0.05
278 0.04
279 0.05
280 0.06
281 0.05
282 0.05
283 0.06
284 0.06
285 0.07
286 0.08
287 0.08
288 0.09
289 0.09
290 0.12
291 0.12
292 0.12
293 0.13
294 0.19
295 0.19
296 0.22
297 0.23
298 0.24
299 0.24
300 0.28
301 0.3
302 0.3
303 0.31
304 0.34
305 0.35
306 0.34
307 0.34
308 0.31
309 0.3
310 0.26
311 0.25
312 0.2
313 0.2
314 0.18
315 0.16
316 0.16
317 0.13
318 0.1
319 0.08
320 0.07
321 0.05
322 0.05
323 0.05
324 0.05
325 0.06
326 0.1
327 0.1
328 0.15
329 0.2
330 0.22
331 0.23
332 0.25
333 0.3
334 0.29
335 0.33
336 0.38
337 0.36
338 0.39
339 0.44
340 0.49
341 0.48
342 0.51
343 0.5
344 0.44
345 0.45
346 0.44
347 0.4
348 0.37
349 0.34
350 0.32
351 0.32
352 0.29
353 0.26
354 0.23
355 0.23
356 0.19
357 0.19
358 0.14
359 0.11
360 0.1
361 0.09
362 0.09
363 0.06
364 0.07
365 0.08
366 0.08
367 0.09
368 0.09
369 0.09
370 0.1
371 0.1
372 0.09
373 0.08
374 0.09
375 0.11
376 0.19
377 0.21
378 0.23
379 0.32
380 0.33
381 0.37
382 0.42
383 0.43
384 0.43
385 0.5
386 0.53
387 0.51
388 0.54
389 0.5
390 0.47
391 0.47
392 0.39
393 0.32
394 0.28
395 0.23
396 0.2
397 0.21
398 0.24
399 0.23
400 0.26
401 0.26
402 0.32
403 0.31
404 0.29
405 0.3
406 0.24
407 0.23
408 0.23
409 0.23
410 0.15
411 0.15
412 0.17
413 0.17
414 0.18
415 0.18
416 0.22
417 0.25
418 0.25
419 0.26
420 0.27
421 0.25
422 0.25
423 0.28
424 0.25
425 0.24
426 0.23
427 0.22
428 0.26
429 0.27
430 0.31
431 0.31
432 0.35
433 0.4
434 0.51
435 0.58
436 0.64
437 0.71
438 0.74
439 0.82
440 0.83
441 0.84
442 0.82
443 0.82
444 0.8
445 0.79
446 0.8
447 0.73
448 0.71
449 0.71
450 0.66
451 0.68
452 0.68
453 0.67
454 0.65
455 0.72
456 0.74
457 0.75
458 0.75
459 0.76
460 0.78
461 0.8
462 0.75
463 0.72
464 0.73
465 0.67
466 0.7