Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A179HN53

Protein Details
Accession A0A179HN53   
Localization Confidence Low
Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
25-51ITRTTCCTSRFRRCRGHQRAAHKWPRGHydrophilic
NLS Segment(s)
Subcellular Location(s) extr 21, plas 5
Family & Domain DBs
KEGG plj:VFPFJ_03487  -  
Amino Acid Sequences MALASNILAALLTVACLDKGGNAVITRTTCCTSRFRRCRGHQRAAHKWPRGQVGSGRMVCLGSARSAQASQASVKADLVDTASDEGPIFSRGSLACRRSRHAWRKQARLYISRVKSSRGGSCIWLRHIIMAIGGGTHTTFCPQLSKRRCVARAFHGSR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.05
2 0.05
3 0.05
4 0.05
5 0.05
6 0.06
7 0.07
8 0.09
9 0.09
10 0.1
11 0.13
12 0.14
13 0.15
14 0.17
15 0.19
16 0.19
17 0.21
18 0.29
19 0.35
20 0.45
21 0.53
22 0.58
23 0.66
24 0.74
25 0.83
26 0.84
27 0.86
28 0.81
29 0.82
30 0.84
31 0.84
32 0.83
33 0.77
34 0.71
35 0.65
36 0.65
37 0.56
38 0.48
39 0.41
40 0.38
41 0.4
42 0.37
43 0.33
44 0.26
45 0.25
46 0.22
47 0.19
48 0.14
49 0.07
50 0.07
51 0.07
52 0.08
53 0.08
54 0.08
55 0.09
56 0.09
57 0.09
58 0.1
59 0.11
60 0.1
61 0.1
62 0.1
63 0.09
64 0.08
65 0.07
66 0.05
67 0.05
68 0.06
69 0.06
70 0.06
71 0.05
72 0.05
73 0.06
74 0.07
75 0.07
76 0.05
77 0.07
78 0.07
79 0.11
80 0.16
81 0.2
82 0.24
83 0.27
84 0.31
85 0.37
86 0.48
87 0.54
88 0.59
89 0.65
90 0.68
91 0.75
92 0.77
93 0.77
94 0.72
95 0.66
96 0.63
97 0.62
98 0.58
99 0.55
100 0.5
101 0.46
102 0.46
103 0.44
104 0.42
105 0.35
106 0.33
107 0.3
108 0.35
109 0.36
110 0.34
111 0.33
112 0.29
113 0.27
114 0.27
115 0.23
116 0.17
117 0.14
118 0.11
119 0.07
120 0.07
121 0.06
122 0.05
123 0.06
124 0.06
125 0.07
126 0.08
127 0.08
128 0.16
129 0.2
130 0.3
131 0.38
132 0.45
133 0.5
134 0.59
135 0.64
136 0.63
137 0.66
138 0.66