Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A179H246

Protein Details
Accession A0A179H246    Localization Confidence Medium Confidence Score 11.1
NoLS Segment(s)
PositionSequenceProtein Nature
44-66ILLSCTCVARRRRRRGAQPMYGTHydrophilic
NLS Segment(s)
PositionSequence
56-56R
Subcellular Location(s) nucl 8, mito 6, extr 5, plas 3, pero 2, golg 2
Family & Domain DBs
InterPro View protein in InterPro  
IPR020999  Chitin_synth_reg_RCR  
Gene Ontology GO:0016020  C:membrane  
KEGG plj:VFPFJ_05263  -  
Pfam View protein in Pfam  
PF12273  RCR  
Amino Acid Sequences MAPTSSELAKRYYCNGYGYCYNSRWYDWGRWVVVGAIIFFCLLILLSCTCVARRRRRRGAQPMYGTGWMAPAGKYGQNGHEMNNYQTGYNQQGYDQQQYQQGWNQQAGYANPPPAYGQQHPQYTGTTFNPNDGYYGQQQGQQYGVQQPAHTYQREGNFSPPPGPPPGK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.33
2 0.33
3 0.34
4 0.37
5 0.4
6 0.4
7 0.36
8 0.37
9 0.34
10 0.35
11 0.34
12 0.33
13 0.33
14 0.34
15 0.38
16 0.36
17 0.34
18 0.33
19 0.29
20 0.26
21 0.2
22 0.14
23 0.09
24 0.08
25 0.07
26 0.07
27 0.06
28 0.04
29 0.04
30 0.03
31 0.04
32 0.05
33 0.06
34 0.07
35 0.07
36 0.08
37 0.16
38 0.24
39 0.34
40 0.44
41 0.54
42 0.64
43 0.73
44 0.82
45 0.86
46 0.87
47 0.85
48 0.79
49 0.72
50 0.64
51 0.56
52 0.45
53 0.34
54 0.25
55 0.16
56 0.12
57 0.08
58 0.07
59 0.08
60 0.09
61 0.1
62 0.1
63 0.11
64 0.16
65 0.17
66 0.17
67 0.2
68 0.2
69 0.2
70 0.22
71 0.21
72 0.15
73 0.15
74 0.16
75 0.15
76 0.15
77 0.14
78 0.11
79 0.16
80 0.19
81 0.22
82 0.22
83 0.2
84 0.23
85 0.24
86 0.25
87 0.23
88 0.25
89 0.23
90 0.23
91 0.22
92 0.18
93 0.2
94 0.19
95 0.2
96 0.18
97 0.18
98 0.17
99 0.17
100 0.17
101 0.18
102 0.23
103 0.2
104 0.25
105 0.29
106 0.32
107 0.33
108 0.33
109 0.31
110 0.27
111 0.29
112 0.25
113 0.26
114 0.24
115 0.25
116 0.25
117 0.24
118 0.25
119 0.21
120 0.22
121 0.18
122 0.22
123 0.2
124 0.22
125 0.23
126 0.22
127 0.23
128 0.2
129 0.2
130 0.2
131 0.24
132 0.21
133 0.21
134 0.23
135 0.28
136 0.32
137 0.31
138 0.29
139 0.3
140 0.36
141 0.42
142 0.41
143 0.4
144 0.41
145 0.42
146 0.43
147 0.4
148 0.36