Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A179HQD9

Protein Details
Accession A0A179HQD9    Localization Confidence Medium Confidence Score 10.4
NoLS Segment(s)
PositionSequenceProtein Nature
6-32KLWAPWKASKIPKRRAHSVGRSSRRPVHydrophilic
NLS Segment(s)
PositionSequence
12-29KASKIPKRRAHSVGRSSR
Subcellular Location(s) mito 16, nucl 7.5, cyto_nucl 5.5, cyto 2.5
Family & Domain DBs
KEGG plj:VFPFJ_01827  -  
Amino Acid Sequences MPAPAKLWAPWKASKIPKRRAHSVGRSSRRPVPDEGSSPPPASVTSVASVTAAASRPPAALGRWQLPDWEWTPEASWTIRGPLRRGLFSHRRPAGLDPVDAGRRPAGAKGHWSADELTFRPCLTSTPARARNPGWACAGDKSSCTPTDGITRLGHADDDSRRPCHCRQELACAGSMEPNPWRAILVARSSTSAAPARRRFVGLSLTLTCRGLVSWRAKPVCLGYLGLPRQGLEPATPNGISAHKPAHACWPRGGLPESRYVRRAGLGWTTVEM
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.64
2 0.68
3 0.72
4 0.76
5 0.78
6 0.81
7 0.8
8 0.81
9 0.82
10 0.82
11 0.82
12 0.82
13 0.8
14 0.77
15 0.77
16 0.72
17 0.65
18 0.6
19 0.55
20 0.52
21 0.5
22 0.49
23 0.48
24 0.45
25 0.41
26 0.37
27 0.31
28 0.25
29 0.23
30 0.2
31 0.15
32 0.14
33 0.14
34 0.14
35 0.13
36 0.13
37 0.1
38 0.11
39 0.09
40 0.08
41 0.09
42 0.09
43 0.09
44 0.1
45 0.11
46 0.1
47 0.15
48 0.19
49 0.23
50 0.25
51 0.25
52 0.25
53 0.25
54 0.28
55 0.24
56 0.24
57 0.2
58 0.18
59 0.18
60 0.18
61 0.19
62 0.15
63 0.16
64 0.12
65 0.16
66 0.18
67 0.19
68 0.21
69 0.26
70 0.28
71 0.28
72 0.3
73 0.34
74 0.42
75 0.45
76 0.52
77 0.48
78 0.46
79 0.46
80 0.46
81 0.46
82 0.38
83 0.32
84 0.24
85 0.24
86 0.25
87 0.23
88 0.22
89 0.13
90 0.12
91 0.13
92 0.14
93 0.13
94 0.12
95 0.17
96 0.18
97 0.2
98 0.19
99 0.2
100 0.19
101 0.18
102 0.2
103 0.17
104 0.16
105 0.15
106 0.14
107 0.13
108 0.12
109 0.11
110 0.13
111 0.17
112 0.2
113 0.28
114 0.36
115 0.37
116 0.4
117 0.39
118 0.43
119 0.41
120 0.39
121 0.31
122 0.25
123 0.24
124 0.23
125 0.24
126 0.16
127 0.14
128 0.14
129 0.14
130 0.14
131 0.14
132 0.13
133 0.12
134 0.17
135 0.18
136 0.18
137 0.16
138 0.16
139 0.16
140 0.16
141 0.15
142 0.1
143 0.12
144 0.12
145 0.18
146 0.2
147 0.21
148 0.22
149 0.26
150 0.29
151 0.36
152 0.37
153 0.39
154 0.39
155 0.46
156 0.5
157 0.48
158 0.46
159 0.37
160 0.33
161 0.28
162 0.26
163 0.18
164 0.14
165 0.15
166 0.13
167 0.13
168 0.13
169 0.1
170 0.12
171 0.14
172 0.16
173 0.17
174 0.17
175 0.18
176 0.19
177 0.18
178 0.19
179 0.21
180 0.21
181 0.28
182 0.32
183 0.34
184 0.34
185 0.36
186 0.34
187 0.32
188 0.32
189 0.25
190 0.25
191 0.25
192 0.26
193 0.25
194 0.25
195 0.22
196 0.17
197 0.15
198 0.14
199 0.18
200 0.22
201 0.26
202 0.34
203 0.35
204 0.36
205 0.37
206 0.37
207 0.33
208 0.28
209 0.24
210 0.19
211 0.27
212 0.28
213 0.28
214 0.26
215 0.23
216 0.23
217 0.23
218 0.2
219 0.13
220 0.16
221 0.16
222 0.2
223 0.19
224 0.18
225 0.19
226 0.2
227 0.2
228 0.19
229 0.21
230 0.21
231 0.23
232 0.23
233 0.33
234 0.38
235 0.39
236 0.39
237 0.42
238 0.41
239 0.46
240 0.48
241 0.42
242 0.38
243 0.45
244 0.48
245 0.46
246 0.44
247 0.41
248 0.4
249 0.37
250 0.36
251 0.3
252 0.3
253 0.28