Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A179HFD3

Protein Details
Accession A0A179HFD3   
Localization Confidence Medium
Confidence Score 10
NoLS Segment(s)
PositionSequenceProtein Nature
66-92GRGLLSMSKRKRRVSRRTEPRGRAQERBasic
NLS Segment(s)
PositionSequence
72-92MSKRKRRVSRRTEPRGRAQER
Subcellular Location(s) mito 20, nucl 5
Family & Domain DBs
KEGG plj:VFPFJ_07189  -  
Amino Acid Sequences MVGGATATHFAKGKNWGWRTGAGPLLALPFGTRPARRTGMLQDAIQWLLARDQLLDGRVQRREHLGRGLLSMSKRKRRVSRRTEPRGRAQER
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.35
2 0.37
3 0.39
4 0.41
5 0.43
6 0.42
7 0.39
8 0.36
9 0.26
10 0.23
11 0.19
12 0.18
13 0.15
14 0.12
15 0.08
16 0.06
17 0.1
18 0.13
19 0.14
20 0.15
21 0.2
22 0.23
23 0.23
24 0.25
25 0.26
26 0.29
27 0.3
28 0.28
29 0.25
30 0.23
31 0.22
32 0.2
33 0.16
34 0.09
35 0.07
36 0.08
37 0.06
38 0.05
39 0.06
40 0.06
41 0.07
42 0.09
43 0.11
44 0.15
45 0.19
46 0.2
47 0.2
48 0.27
49 0.29
50 0.3
51 0.32
52 0.31
53 0.27
54 0.28
55 0.29
56 0.25
57 0.25
58 0.31
59 0.35
60 0.41
61 0.48
62 0.55
63 0.64
64 0.71
65 0.79
66 0.81
67 0.84
68 0.86
69 0.9
70 0.92
71 0.89
72 0.89