Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A179HUP7

Protein Details
Accession A0A179HUP7   
Localization Confidence Medium
Confidence Score 14.4
NoLS Segment(s)
PositionSequenceProtein Nature
275-296DSDNSHKKKKLKPSASMTKKVIHydrophilic
NLS Segment(s)
PositionSequence
164-172PGRGKKKKD
280-309HKKKKLKPSASMTKKVIIKSKPMLKKEKSK
336-350KMAHKDGSPLKKVKA
Subcellular Location(s) nucl 13.5, mito_nucl 11.332, cyto_nucl 10.499, mito 7.5, cyto_mito 7.499, cyto 5
Family & Domain DBs
KEGG plj:VFPFJ_00215  -  
Amino Acid Sequences MNSTTGRAGVIRARDDAGNMDKLVSPFLPAAHAILDDVLYNVLSDLVMKTHREEKTARANTAAIRVEKLASDASDTSVPDAKPDVRVETDAAIYEDGKVLLKGNPLQTTQDILCPKCHLPRLLYPTDGKGARKPDPTVIYCKKHPYIDKPGCDIYGQSWVAPGPGRGKKKKDMEKKDGTDSPATPEQRPPNVLSFPSATCSKCKRCILVTRLNNHMGSCIGNSGRNASRAAAQKLNNGGSQHDSTPPSSQKATPAPGSRASSPRKRDASDDDGADSDNSHKKKKLKPSASMTKKVIIKSKPMLKKEKSKGASQLSQEQKLDDSDTPHLTPRKGTPKMAHKDGSPLKKVKAAKPMTSSPVSKNGREPDGESESSGTLSSPPGK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.26
2 0.26
3 0.29
4 0.28
5 0.26
6 0.24
7 0.23
8 0.24
9 0.24
10 0.26
11 0.2
12 0.18
13 0.15
14 0.16
15 0.16
16 0.13
17 0.14
18 0.12
19 0.12
20 0.1
21 0.1
22 0.09
23 0.07
24 0.08
25 0.07
26 0.06
27 0.06
28 0.06
29 0.05
30 0.05
31 0.06
32 0.06
33 0.08
34 0.1
35 0.12
36 0.15
37 0.23
38 0.24
39 0.28
40 0.29
41 0.34
42 0.43
43 0.49
44 0.46
45 0.41
46 0.41
47 0.39
48 0.45
49 0.42
50 0.32
51 0.27
52 0.27
53 0.25
54 0.23
55 0.23
56 0.17
57 0.12
58 0.14
59 0.13
60 0.14
61 0.15
62 0.15
63 0.16
64 0.19
65 0.19
66 0.17
67 0.2
68 0.19
69 0.21
70 0.23
71 0.24
72 0.21
73 0.23
74 0.23
75 0.21
76 0.2
77 0.17
78 0.16
79 0.13
80 0.11
81 0.1
82 0.1
83 0.08
84 0.08
85 0.08
86 0.08
87 0.1
88 0.13
89 0.16
90 0.19
91 0.22
92 0.22
93 0.25
94 0.24
95 0.25
96 0.22
97 0.25
98 0.25
99 0.23
100 0.24
101 0.25
102 0.27
103 0.29
104 0.33
105 0.3
106 0.3
107 0.37
108 0.43
109 0.42
110 0.42
111 0.38
112 0.36
113 0.38
114 0.37
115 0.3
116 0.27
117 0.3
118 0.33
119 0.35
120 0.35
121 0.36
122 0.39
123 0.4
124 0.45
125 0.47
126 0.46
127 0.46
128 0.51
129 0.48
130 0.47
131 0.49
132 0.47
133 0.51
134 0.54
135 0.54
136 0.51
137 0.49
138 0.44
139 0.4
140 0.32
141 0.22
142 0.22
143 0.19
144 0.15
145 0.14
146 0.13
147 0.14
148 0.14
149 0.14
150 0.14
151 0.2
152 0.28
153 0.34
154 0.39
155 0.46
156 0.55
157 0.64
158 0.67
159 0.71
160 0.73
161 0.76
162 0.75
163 0.72
164 0.66
165 0.59
166 0.51
167 0.42
168 0.37
169 0.33
170 0.31
171 0.26
172 0.29
173 0.3
174 0.29
175 0.31
176 0.28
177 0.26
178 0.25
179 0.25
180 0.21
181 0.19
182 0.17
183 0.17
184 0.18
185 0.15
186 0.18
187 0.25
188 0.27
189 0.33
190 0.35
191 0.35
192 0.38
193 0.46
194 0.49
195 0.52
196 0.54
197 0.5
198 0.53
199 0.53
200 0.48
201 0.39
202 0.32
203 0.23
204 0.17
205 0.14
206 0.11
207 0.09
208 0.1
209 0.1
210 0.14
211 0.15
212 0.16
213 0.16
214 0.15
215 0.2
216 0.23
217 0.27
218 0.28
219 0.28
220 0.3
221 0.33
222 0.34
223 0.3
224 0.25
225 0.23
226 0.21
227 0.22
228 0.19
229 0.2
230 0.19
231 0.19
232 0.23
233 0.24
234 0.24
235 0.24
236 0.24
237 0.25
238 0.28
239 0.31
240 0.31
241 0.33
242 0.33
243 0.36
244 0.38
245 0.37
246 0.4
247 0.43
248 0.46
249 0.48
250 0.54
251 0.53
252 0.52
253 0.53
254 0.52
255 0.52
256 0.48
257 0.43
258 0.35
259 0.31
260 0.3
261 0.25
262 0.19
263 0.16
264 0.19
265 0.2
266 0.24
267 0.29
268 0.36
269 0.45
270 0.55
271 0.62
272 0.64
273 0.71
274 0.77
275 0.82
276 0.83
277 0.83
278 0.74
279 0.7
280 0.65
281 0.6
282 0.58
283 0.5
284 0.49
285 0.49
286 0.56
287 0.58
288 0.62
289 0.68
290 0.67
291 0.75
292 0.76
293 0.78
294 0.71
295 0.69
296 0.7
297 0.68
298 0.67
299 0.6
300 0.61
301 0.57
302 0.59
303 0.54
304 0.46
305 0.39
306 0.35
307 0.34
308 0.26
309 0.24
310 0.23
311 0.26
312 0.27
313 0.32
314 0.34
315 0.32
316 0.34
317 0.38
318 0.44
319 0.46
320 0.51
321 0.53
322 0.6
323 0.67
324 0.71
325 0.65
326 0.56
327 0.61
328 0.64
329 0.64
330 0.61
331 0.57
332 0.53
333 0.57
334 0.62
335 0.58
336 0.6
337 0.58
338 0.57
339 0.59
340 0.63
341 0.62
342 0.62
343 0.58
344 0.52
345 0.56
346 0.54
347 0.5
348 0.52
349 0.52
350 0.51
351 0.5
352 0.48
353 0.46
354 0.48
355 0.46
356 0.39
357 0.34
358 0.3
359 0.28
360 0.25
361 0.18
362 0.12