Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A179H2W1

Protein Details
Accession A0A179H2W1   
Localization Confidence Medium
Confidence Score 13.6
NoLS Segment(s)
PositionSequenceProtein Nature
78-110VDSKKTSKARIDKKRIGKRKAKKSKIVFPKYSDBasic
NLS Segment(s)
PositionSequence
81-119KKTSKARIDKKRIGKRKAKKSKIVFPKYSDRAGKKKGGK
Subcellular Location(s) nucl 15, mito 12
Family & Domain DBs
InterPro View protein in InterPro  
IPR019434  DUF2423  
KEGG plj:VFPFJ_04841  -  
Pfam View protein in Pfam  
PF10338  DUF2423  
Amino Acid Sequences MAKSSRSSTIKANNRRKAASVFGPAEIARNERLSAKLLELAKQPKPETSDVNMDAAEEDAAAEENADADGADDAAMDVDSKKTSKARIDKKRIGKRKAKKSKIVFPKYSDRAGKKKGGK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.72
2 0.72
3 0.68
4 0.61
5 0.57
6 0.52
7 0.49
8 0.42
9 0.37
10 0.36
11 0.32
12 0.31
13 0.26
14 0.22
15 0.16
16 0.15
17 0.15
18 0.15
19 0.17
20 0.17
21 0.17
22 0.16
23 0.19
24 0.18
25 0.2
26 0.24
27 0.27
28 0.28
29 0.31
30 0.31
31 0.28
32 0.31
33 0.31
34 0.3
35 0.28
36 0.3
37 0.27
38 0.27
39 0.24
40 0.2
41 0.18
42 0.14
43 0.11
44 0.05
45 0.04
46 0.03
47 0.03
48 0.03
49 0.03
50 0.02
51 0.03
52 0.03
53 0.03
54 0.03
55 0.03
56 0.03
57 0.03
58 0.03
59 0.03
60 0.03
61 0.03
62 0.03
63 0.03
64 0.03
65 0.04
66 0.06
67 0.06
68 0.09
69 0.11
70 0.15
71 0.24
72 0.33
73 0.43
74 0.53
75 0.63
76 0.7
77 0.79
78 0.86
79 0.87
80 0.88
81 0.87
82 0.87
83 0.88
84 0.9
85 0.89
86 0.88
87 0.88
88 0.88
89 0.89
90 0.88
91 0.83
92 0.78
93 0.79
94 0.74
95 0.73
96 0.71
97 0.68
98 0.67
99 0.68