Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

I3EEL3

Protein Details
Accession I3EEL3    Localization Confidence Low Confidence Score 9.8
NoLS Segment(s)
PositionSequenceProtein Nature
57-83CTMSTKYTNNKIKRKRKEIQDKNFKEAHydrophilic
NLS Segment(s)
PositionSequence
68-73IKRKRK
Subcellular Location(s) nucl 5mito 5mito_nucl 5, E.R. 4, plas 3, pero 3, golg 3
Family & Domain DBs
Amino Acid Sequences MNKLYLIIYLSLLLIVQCTDYIKYNTLSNKQCKECGSKIPRYITQPVKSNNQSNNLCTMSTKYTNNKIKRKRKEIQDKNFKEAEERRDYQKQQDIIRKRIKELDREMKALNIKQMKISKELAKESYNKKRYPYNIPRPGGVIYNGRINPLNTTENKPKYNT
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.06
2 0.05
3 0.05
4 0.05
5 0.07
6 0.08
7 0.12
8 0.14
9 0.16
10 0.18
11 0.22
12 0.28
13 0.35
14 0.42
15 0.47
16 0.53
17 0.54
18 0.56
19 0.55
20 0.57
21 0.53
22 0.55
23 0.55
24 0.55
25 0.58
26 0.6
27 0.6
28 0.58
29 0.62
30 0.6
31 0.57
32 0.56
33 0.54
34 0.56
35 0.57
36 0.58
37 0.54
38 0.55
39 0.51
40 0.45
41 0.46
42 0.38
43 0.33
44 0.27
45 0.26
46 0.21
47 0.23
48 0.26
49 0.25
50 0.34
51 0.43
52 0.51
53 0.58
54 0.64
55 0.71
56 0.77
57 0.82
58 0.8
59 0.82
60 0.85
61 0.86
62 0.86
63 0.87
64 0.8
65 0.76
66 0.7
67 0.59
68 0.53
69 0.46
70 0.42
71 0.38
72 0.37
73 0.37
74 0.42
75 0.43
76 0.44
77 0.45
78 0.43
79 0.42
80 0.49
81 0.5
82 0.52
83 0.59
84 0.54
85 0.51
86 0.55
87 0.52
88 0.51
89 0.53
90 0.54
91 0.49
92 0.51
93 0.49
94 0.44
95 0.45
96 0.38
97 0.36
98 0.31
99 0.28
100 0.31
101 0.36
102 0.34
103 0.34
104 0.37
105 0.36
106 0.36
107 0.4
108 0.37
109 0.37
110 0.42
111 0.47
112 0.54
113 0.55
114 0.53
115 0.53
116 0.57
117 0.59
118 0.63
119 0.65
120 0.66
121 0.68
122 0.68
123 0.66
124 0.6
125 0.56
126 0.47
127 0.4
128 0.33
129 0.25
130 0.31
131 0.3
132 0.3
133 0.31
134 0.29
135 0.29
136 0.29
137 0.33
138 0.29
139 0.37
140 0.45
141 0.5