Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

I3EI06

Protein Details
Accession I3EI06    Localization Confidence Low Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
20-40ATDCNKKSRSRSPSPRCDAHCHydrophilic
NLS Segment(s)
Subcellular Location(s) extr 17, E.R. 7, cyto 1, pero 1, golg 1, cyto_pero 1
Family & Domain DBs
InterPro View protein in InterPro  
IPR009030  Growth_fac_rcpt_cys_sf  
Amino Acid Sequences MKVTYTLIAIVLVVLGLVSATDCNKKSRSRSPSPRCDAHCPPGFTKNANGECVKNDDCQNPNCKNCPPGFTKNENGECVRNDDCEDPNACKHCPPGFTKNANGECVRKSRACR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.03
2 0.02
3 0.02
4 0.02
5 0.02
6 0.03
7 0.05
8 0.1
9 0.11
10 0.16
11 0.2
12 0.26
13 0.33
14 0.43
15 0.5
16 0.57
17 0.67
18 0.73
19 0.8
20 0.81
21 0.8
22 0.76
23 0.75
24 0.7
25 0.67
26 0.63
27 0.56
28 0.52
29 0.51
30 0.47
31 0.4
32 0.38
33 0.38
34 0.33
35 0.33
36 0.31
37 0.26
38 0.26
39 0.29
40 0.26
41 0.2
42 0.21
43 0.22
44 0.23
45 0.26
46 0.32
47 0.32
48 0.34
49 0.35
50 0.34
51 0.35
52 0.33
53 0.35
54 0.35
55 0.38
56 0.41
57 0.43
58 0.48
59 0.51
60 0.53
61 0.51
62 0.46
63 0.41
64 0.35
65 0.35
66 0.3
67 0.23
68 0.22
69 0.22
70 0.21
71 0.22
72 0.23
73 0.22
74 0.26
75 0.29
76 0.27
77 0.27
78 0.31
79 0.31
80 0.33
81 0.37
82 0.41
83 0.46
84 0.5
85 0.53
86 0.55
87 0.53
88 0.53
89 0.5
90 0.45
91 0.4
92 0.42
93 0.43