Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

I3ED10

Protein Details
Accession I3ED10    Localization Confidence Medium Confidence Score 13.9
NoLS Segment(s)
PositionSequenceProtein Nature
57-78NKILILKKKKVEDQKKKRIGIVHydrophilic
NLS Segment(s)
PositionSequence
59-74ILILKKKKVEDQKKKR
Subcellular Location(s) nucl 22.5, cyto_nucl 13, cyto 2.5
Family & Domain DBs
Amino Acid Sequences SEDRYLSIESESPDSFTRFLRRHENKSDSFNLLASLFLLSEGINIPIRIVEGKVNKNKILILKKKKVEDQKKKRIGIVVLNMMS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.21
2 0.2
3 0.21
4 0.27
5 0.26
6 0.3
7 0.39
8 0.45
9 0.51
10 0.59
11 0.63
12 0.58
13 0.61
14 0.6
15 0.52
16 0.45
17 0.37
18 0.29
19 0.22
20 0.19
21 0.12
22 0.09
23 0.06
24 0.05
25 0.05
26 0.04
27 0.04
28 0.04
29 0.05
30 0.05
31 0.05
32 0.05
33 0.05
34 0.06
35 0.06
36 0.06
37 0.1
38 0.15
39 0.22
40 0.29
41 0.32
42 0.32
43 0.33
44 0.35
45 0.38
46 0.42
47 0.45
48 0.5
49 0.55
50 0.61
51 0.66
52 0.71
53 0.75
54 0.76
55 0.78
56 0.79
57 0.81
58 0.84
59 0.82
60 0.78
61 0.73
62 0.67
63 0.64
64 0.6