Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A175VYS1

Protein Details
Accession A0A175VYS1   
Localization Confidence Low
Confidence Score 9.4
NoLS Segment(s)
PositionSequenceProtein Nature
129-164RDDGRGKGKGKRERRLRRKRETAKGRQERRREGKEEBasic
NLS Segment(s)
PositionSequence
132-162GRGKGKGKRERRLRRKRETAKGRQERRREGK
Subcellular Location(s) cyto 14.5, cyto_nucl 10.833, nucl 6, mito_nucl 5.833, mito 4.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR011893  Selenoprotein_Rdx-typ  
IPR036249  Thioredoxin-like_sf  
Pfam View protein in Pfam  
PF10262  Rdx  
Amino Acid Sequences MAEIAGGPTEPRLPRITIQFCTQCKWMLRAAYYAQELLSTFSTSLGEVALQPATGGVFVVEIATLASASGEASTVVAADNDQPRQRRPAPAATVLWDRKVDGGFPETKELKRRVRDVIQPGRDLGHVDRDDGRGKGKGKRERRLRRKRETAKGRQERRREGKEEKYVMLGEGRSVTIANESERMEVGRNGDGRHERCGFDVEPTSIP
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.26
2 0.35
3 0.4
4 0.37
5 0.44
6 0.49
7 0.48
8 0.49
9 0.47
10 0.43
11 0.4
12 0.4
13 0.37
14 0.34
15 0.34
16 0.34
17 0.34
18 0.33
19 0.31
20 0.29
21 0.23
22 0.19
23 0.18
24 0.16
25 0.15
26 0.11
27 0.1
28 0.1
29 0.11
30 0.1
31 0.1
32 0.07
33 0.06
34 0.06
35 0.07
36 0.06
37 0.06
38 0.05
39 0.05
40 0.05
41 0.05
42 0.04
43 0.03
44 0.03
45 0.03
46 0.03
47 0.03
48 0.03
49 0.03
50 0.03
51 0.03
52 0.03
53 0.03
54 0.03
55 0.03
56 0.03
57 0.03
58 0.03
59 0.03
60 0.03
61 0.03
62 0.03
63 0.03
64 0.04
65 0.07
66 0.09
67 0.12
68 0.16
69 0.17
70 0.19
71 0.26
72 0.29
73 0.31
74 0.32
75 0.37
76 0.38
77 0.4
78 0.39
79 0.35
80 0.39
81 0.34
82 0.32
83 0.24
84 0.21
85 0.18
86 0.17
87 0.14
88 0.09
89 0.11
90 0.12
91 0.12
92 0.16
93 0.17
94 0.18
95 0.24
96 0.29
97 0.33
98 0.35
99 0.38
100 0.39
101 0.42
102 0.48
103 0.52
104 0.56
105 0.52
106 0.49
107 0.46
108 0.41
109 0.36
110 0.31
111 0.21
112 0.2
113 0.17
114 0.18
115 0.19
116 0.21
117 0.22
118 0.21
119 0.23
120 0.19
121 0.22
122 0.27
123 0.34
124 0.42
125 0.49
126 0.58
127 0.67
128 0.74
129 0.83
130 0.88
131 0.89
132 0.9
133 0.92
134 0.92
135 0.92
136 0.92
137 0.91
138 0.91
139 0.91
140 0.91
141 0.89
142 0.88
143 0.88
144 0.86
145 0.84
146 0.79
147 0.77
148 0.77
149 0.77
150 0.72
151 0.63
152 0.56
153 0.48
154 0.42
155 0.36
156 0.26
157 0.18
158 0.15
159 0.14
160 0.11
161 0.11
162 0.1
163 0.1
164 0.11
165 0.12
166 0.14
167 0.15
168 0.15
169 0.16
170 0.17
171 0.16
172 0.17
173 0.18
174 0.2
175 0.22
176 0.21
177 0.28
178 0.36
179 0.36
180 0.41
181 0.41
182 0.37
183 0.36
184 0.41
185 0.34
186 0.31
187 0.34