Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

I3EIX0

Protein Details
Accession I3EIX0    Localization Confidence High Confidence Score 16.1
NoLS Segment(s)
PositionSequenceProtein Nature
1-31MAGKKVDPKAQQKKDKAPKKVEAKKWTKTESHydrophilic
NLS Segment(s)
PositionSequence
6-32VDPKAQQKKDKAPKKVEAKKWTKTESK
Subcellular Location(s) nucl 21, cyto 5
Family & Domain DBs
InterPro View protein in InterPro  
IPR004977  Ribosomal_S25  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
Pfam View protein in Pfam  
PF03297  Ribosomal_S25  
Amino Acid Sequences MAGKKVDPKAQQKKDKAPKKVEAKKWTKTESKAKQLKTSVITQDIFNKIKKEVLNMSLITPATIAARNNFEVALAKNILDQIVESGEIEIIAKSSFGRIYGKKEAKEVKEIKEEAISA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.87
2 0.88
3 0.87
4 0.84
5 0.84
6 0.84
7 0.86
8 0.85
9 0.85
10 0.84
11 0.83
12 0.81
13 0.79
14 0.74
15 0.72
16 0.73
17 0.71
18 0.73
19 0.72
20 0.68
21 0.68
22 0.64
23 0.61
24 0.54
25 0.5
26 0.42
27 0.39
28 0.37
29 0.3
30 0.32
31 0.33
32 0.32
33 0.28
34 0.26
35 0.22
36 0.26
37 0.25
38 0.23
39 0.21
40 0.21
41 0.22
42 0.21
43 0.21
44 0.19
45 0.18
46 0.15
47 0.11
48 0.09
49 0.07
50 0.08
51 0.08
52 0.08
53 0.1
54 0.11
55 0.11
56 0.11
57 0.1
58 0.1
59 0.11
60 0.12
61 0.1
62 0.1
63 0.1
64 0.1
65 0.1
66 0.08
67 0.07
68 0.05
69 0.05
70 0.06
71 0.05
72 0.05
73 0.05
74 0.05
75 0.06
76 0.05
77 0.05
78 0.05
79 0.05
80 0.05
81 0.06
82 0.07
83 0.08
84 0.14
85 0.17
86 0.24
87 0.34
88 0.41
89 0.41
90 0.48
91 0.55
92 0.53
93 0.61
94 0.59
95 0.55
96 0.58
97 0.58
98 0.52