Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

I3EGR8

Protein Details
Accession I3EGR8   
Localization Confidence Medium
Confidence Score 12.6
NoLS Segment(s)
PositionSequenceProtein Nature
3-37IDFSKKKKLVSYKEKTPKKQRKQTKKEKTVKLSDVHydrophilic
NLS Segment(s)
PositionSequence
7-30KKKKLVSYKEKTPKKQRKQTKKEK
Subcellular Location(s) nucl 18, cyto_nucl 12.5, cyto 5, mito 4
Family & Domain DBs
Amino Acid Sequences MLIDFSKKKKLVSYKEKTPKKQRKQTKKEKTVKLSDVDKLFLKSKELFDETPSIFADIPYENTEIAVMVDPCTKTYKNPATLYEQYKDRIH
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.69
2 0.78
3 0.85
4 0.87
5 0.88
6 0.89
7 0.89
8 0.9
9 0.9
10 0.91
11 0.93
12 0.94
13 0.94
14 0.94
15 0.93
16 0.92
17 0.89
18 0.86
19 0.79
20 0.73
21 0.64
22 0.58
23 0.49
24 0.41
25 0.34
26 0.28
27 0.27
28 0.22
29 0.21
30 0.19
31 0.18
32 0.19
33 0.21
34 0.19
35 0.18
36 0.22
37 0.19
38 0.19
39 0.18
40 0.16
41 0.13
42 0.12
43 0.12
44 0.09
45 0.1
46 0.11
47 0.12
48 0.1
49 0.1
50 0.1
51 0.09
52 0.09
53 0.09
54 0.07
55 0.08
56 0.11
57 0.11
58 0.12
59 0.17
60 0.16
61 0.17
62 0.27
63 0.35
64 0.4
65 0.43
66 0.45
67 0.5
68 0.57
69 0.6
70 0.55
71 0.51