Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

I3EF01

Protein Details
Accession I3EF01   
Localization Confidence Medium
Confidence Score 10.1
NoLS Segment(s)
PositionSequenceProtein Nature
17-42IKSTEVTLKRRQSKRSKTLPNIHKEIHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 19, cyto_nucl 11, mito 7
Family & Domain DBs
Amino Acid Sequences MEKKKRTHWTTNYLKRIKSTEVTLKRRQSKRSKTLPNIHKEIEIMPIFTKEKEEKVLRTPDRVIHTPKRNLVYISPQHNITIPPTPHGASEEYISETRSRKRLFT
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.75
2 0.68
3 0.64
4 0.58
5 0.51
6 0.47
7 0.47
8 0.52
9 0.57
10 0.62
11 0.67
12 0.72
13 0.75
14 0.77
15 0.78
16 0.78
17 0.8
18 0.82
19 0.84
20 0.83
21 0.87
22 0.86
23 0.82
24 0.76
25 0.67
26 0.57
27 0.48
28 0.39
29 0.34
30 0.26
31 0.19
32 0.14
33 0.16
34 0.16
35 0.15
36 0.17
37 0.12
38 0.13
39 0.18
40 0.2
41 0.19
42 0.24
43 0.33
44 0.32
45 0.34
46 0.34
47 0.34
48 0.37
49 0.39
50 0.4
51 0.4
52 0.47
53 0.49
54 0.53
55 0.51
56 0.47
57 0.45
58 0.4
59 0.41
60 0.39
61 0.39
62 0.37
63 0.34
64 0.33
65 0.33
66 0.31
67 0.25
68 0.27
69 0.22
70 0.22
71 0.24
72 0.24
73 0.23
74 0.25
75 0.24
76 0.17
77 0.18
78 0.17
79 0.18
80 0.18
81 0.19
82 0.21
83 0.24
84 0.29
85 0.36