Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A175VX28

Protein Details
Accession A0A175VX28   
Localization Confidence Low
Confidence Score 9.2
NoLS Segment(s)
PositionSequenceProtein Nature
2-49VAAKKHIPIVKKRTKRFMRHQSDRFKCVDSAWRKPKGIDNRVRRRFKSHydrophilic
NLS Segment(s)
PositionSequence
11-17VKKRTKR
Subcellular Location(s) mito 20.5, mito_nucl 13.333, nucl 5, cyto_nucl 3.833
Family & Domain DBs
InterPro View protein in InterPro  
IPR001515  Ribosomal_L32e  
IPR036351  Ribosomal_L32e_sf  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF01655  Ribosomal_L32e  
CDD cd00513  Ribosomal_L32_L32e  
Amino Acid Sequences MVAAKKHIPIVKKRTKRFMRHQSDRFKCVDSAWRKPKGIDNRVRRRFKSNLAMPSIGYGSNKKTRHMMPSGHKAFLVSNVKDVELLLMHNKTHAAEIAHNVSSRKRIDIITRAKQLGVKVTNPKAKVTTEV
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.76
2 0.83
3 0.86
4 0.87
5 0.87
6 0.88
7 0.88
8 0.89
9 0.9
10 0.86
11 0.81
12 0.73
13 0.64
14 0.54
15 0.46
16 0.46
17 0.43
18 0.46
19 0.5
20 0.54
21 0.52
22 0.54
23 0.6
24 0.6
25 0.63
26 0.62
27 0.65
28 0.69
29 0.78
30 0.84
31 0.78
32 0.74
33 0.68
34 0.66
35 0.65
36 0.61
37 0.57
38 0.54
39 0.52
40 0.45
41 0.41
42 0.34
43 0.24
44 0.18
45 0.13
46 0.13
47 0.21
48 0.21
49 0.21
50 0.25
51 0.26
52 0.31
53 0.33
54 0.35
55 0.34
56 0.44
57 0.45
58 0.42
59 0.39
60 0.35
61 0.31
62 0.32
63 0.32
64 0.21
65 0.22
66 0.22
67 0.22
68 0.21
69 0.21
70 0.14
71 0.08
72 0.09
73 0.09
74 0.09
75 0.09
76 0.1
77 0.1
78 0.1
79 0.1
80 0.11
81 0.1
82 0.11
83 0.14
84 0.18
85 0.19
86 0.2
87 0.2
88 0.2
89 0.24
90 0.24
91 0.23
92 0.22
93 0.23
94 0.29
95 0.37
96 0.45
97 0.48
98 0.53
99 0.51
100 0.5
101 0.5
102 0.45
103 0.45
104 0.39
105 0.37
106 0.4
107 0.47
108 0.53
109 0.52
110 0.54
111 0.48