Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A175W4A5

Protein Details
Accession A0A175W4A5   
Localization Confidence Medium
Confidence Score 12.5
NoLS Segment(s)
PositionSequenceProtein Nature
261-294GGPKPVKKGRVTKSTQKGKTKGSGPKKTKTGKARBasic
NLS Segment(s)
PositionSequence
249-294KELRKKNPAKTSGGPKPVKKGRVTKSTQKGKTKGSGPKKTKTGKAR
Subcellular Location(s) nucl 15, mito 6, cyto 6, cyto_mito 6
Family & Domain DBs
Amino Acid Sequences MPQSVVSVARDSAIDTYLSNASSMTELIDLIPATYRAALSRILRGHFAMSQKISNCQQILATLNRHKSDGTFPQTVLAAIKQPNIQYSKEFMGGAGQKTAQEEIESNIKAVRTNLLDALVRHKTAELNVLQSHMSFDGDEWKAQCTRVAKNMADVLGQAAPEGSENPFASGMNKTSVREWERVHNNGRAWYARAVSLAYVAIEKTVARKMTKLSLKDKADTEMKDASDEQPTASVIDDKLSAFKAELLKELRKKNPAKTSGGPKPVKKGRVTKSTQKGKTKGSGPKKTKTGKAR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.12
2 0.1
3 0.13
4 0.14
5 0.14
6 0.13
7 0.11
8 0.11
9 0.11
10 0.11
11 0.09
12 0.07
13 0.07
14 0.07
15 0.09
16 0.08
17 0.08
18 0.09
19 0.08
20 0.09
21 0.09
22 0.09
23 0.09
24 0.1
25 0.15
26 0.16
27 0.22
28 0.25
29 0.26
30 0.27
31 0.27
32 0.28
33 0.27
34 0.28
35 0.27
36 0.25
37 0.28
38 0.28
39 0.33
40 0.33
41 0.34
42 0.32
43 0.27
44 0.25
45 0.23
46 0.26
47 0.24
48 0.28
49 0.3
50 0.35
51 0.35
52 0.35
53 0.33
54 0.31
55 0.34
56 0.36
57 0.36
58 0.33
59 0.32
60 0.32
61 0.32
62 0.31
63 0.25
64 0.17
65 0.15
66 0.14
67 0.16
68 0.17
69 0.17
70 0.22
71 0.23
72 0.24
73 0.21
74 0.24
75 0.23
76 0.23
77 0.22
78 0.17
79 0.2
80 0.22
81 0.21
82 0.18
83 0.16
84 0.15
85 0.16
86 0.17
87 0.11
88 0.09
89 0.09
90 0.1
91 0.14
92 0.14
93 0.13
94 0.14
95 0.14
96 0.14
97 0.14
98 0.15
99 0.11
100 0.12
101 0.12
102 0.13
103 0.14
104 0.13
105 0.18
106 0.17
107 0.16
108 0.15
109 0.15
110 0.14
111 0.13
112 0.18
113 0.13
114 0.14
115 0.14
116 0.15
117 0.14
118 0.14
119 0.14
120 0.1
121 0.09
122 0.06
123 0.06
124 0.11
125 0.12
126 0.12
127 0.12
128 0.13
129 0.14
130 0.14
131 0.17
132 0.13
133 0.15
134 0.2
135 0.24
136 0.22
137 0.24
138 0.25
139 0.23
140 0.2
141 0.18
142 0.13
143 0.09
144 0.09
145 0.07
146 0.05
147 0.05
148 0.05
149 0.05
150 0.05
151 0.07
152 0.07
153 0.08
154 0.08
155 0.08
156 0.1
157 0.1
158 0.11
159 0.12
160 0.13
161 0.13
162 0.14
163 0.21
164 0.23
165 0.26
166 0.26
167 0.32
168 0.37
169 0.41
170 0.44
171 0.42
172 0.4
173 0.39
174 0.4
175 0.32
176 0.29
177 0.26
178 0.22
179 0.18
180 0.17
181 0.14
182 0.12
183 0.11
184 0.09
185 0.07
186 0.07
187 0.06
188 0.05
189 0.05
190 0.05
191 0.07
192 0.11
193 0.14
194 0.14
195 0.16
196 0.18
197 0.27
198 0.33
199 0.37
200 0.39
201 0.46
202 0.48
203 0.5
204 0.49
205 0.45
206 0.44
207 0.39
208 0.37
209 0.32
210 0.29
211 0.27
212 0.27
213 0.24
214 0.23
215 0.22
216 0.18
217 0.15
218 0.15
219 0.14
220 0.13
221 0.13
222 0.09
223 0.1
224 0.11
225 0.1
226 0.12
227 0.12
228 0.12
229 0.1
230 0.14
231 0.17
232 0.17
233 0.22
234 0.26
235 0.33
236 0.4
237 0.48
238 0.51
239 0.57
240 0.62
241 0.66
242 0.71
243 0.69
244 0.69
245 0.69
246 0.73
247 0.72
248 0.77
249 0.75
250 0.68
251 0.72
252 0.73
253 0.72
254 0.7
255 0.71
256 0.69
257 0.73
258 0.76
259 0.77
260 0.79
261 0.83
262 0.84
263 0.84
264 0.81
265 0.78
266 0.78
267 0.77
268 0.77
269 0.77
270 0.78
271 0.76
272 0.78
273 0.81
274 0.81