Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A175VV03

Protein Details
Accession A0A175VV03   
Localization Confidence Medium
Confidence Score 10.9
NoLS Segment(s)
PositionSequenceProtein Nature
43-71IYRKSSITPSKGKRRRSRNKVKAPGSELPHydrophilic
NLS Segment(s)
PositionSequence
51-65PSKGKRRRSRNKVKA
Subcellular Location(s) nucl 12.5, cyto_nucl 9.333, mito 8.5, cyto_mito 7.333, cyto 5
Family & Domain DBs
InterPro View protein in InterPro  
IPR013241  RNase_P_Pop3  
Gene Ontology GO:0006364  P:rRNA processing  
GO:0008033  P:tRNA processing  
Pfam View protein in Pfam  
PF08228  RNase_P_pop3  
Amino Acid Sequences MERKRIVHVLDTPYTAVEWPQVSQEDQDAILELLCRLLTPLGIYRKSSITPSKGKRRRSRNKVKAPGSELPAAATPAPPAPELAAHVDVGLSKISRTLQHMSAKKDGVGQTAEDAAAPYSAVFVARSGQSPAFHCHFPQMIALAAQSQSPEKAVRLVGFSKSCEERLSAALGIPRASSIGLREDAPQAKGLIDFVREHVAPVQVPWLDEARSAKFLETNIDAVPTRIGNKKPRLS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.31
2 0.25
3 0.19
4 0.15
5 0.13
6 0.12
7 0.15
8 0.17
9 0.17
10 0.18
11 0.19
12 0.17
13 0.16
14 0.15
15 0.13
16 0.11
17 0.1
18 0.1
19 0.08
20 0.07
21 0.07
22 0.06
23 0.06
24 0.06
25 0.06
26 0.08
27 0.14
28 0.21
29 0.23
30 0.24
31 0.26
32 0.28
33 0.29
34 0.33
35 0.33
36 0.33
37 0.41
38 0.49
39 0.58
40 0.63
41 0.72
42 0.76
43 0.81
44 0.85
45 0.87
46 0.89
47 0.89
48 0.93
49 0.93
50 0.91
51 0.86
52 0.82
53 0.76
54 0.69
55 0.6
56 0.49
57 0.4
58 0.33
59 0.26
60 0.19
61 0.14
62 0.1
63 0.09
64 0.1
65 0.09
66 0.08
67 0.08
68 0.08
69 0.09
70 0.12
71 0.11
72 0.1
73 0.1
74 0.09
75 0.09
76 0.09
77 0.08
78 0.05
79 0.04
80 0.06
81 0.07
82 0.09
83 0.12
84 0.15
85 0.2
86 0.28
87 0.32
88 0.35
89 0.38
90 0.37
91 0.33
92 0.34
93 0.29
94 0.23
95 0.2
96 0.16
97 0.12
98 0.12
99 0.12
100 0.08
101 0.07
102 0.05
103 0.04
104 0.04
105 0.03
106 0.03
107 0.03
108 0.03
109 0.03
110 0.03
111 0.05
112 0.05
113 0.06
114 0.08
115 0.09
116 0.1
117 0.12
118 0.16
119 0.17
120 0.17
121 0.17
122 0.18
123 0.17
124 0.16
125 0.15
126 0.11
127 0.09
128 0.09
129 0.09
130 0.07
131 0.07
132 0.07
133 0.07
134 0.06
135 0.06
136 0.07
137 0.08
138 0.08
139 0.1
140 0.11
141 0.11
142 0.14
143 0.15
144 0.18
145 0.19
146 0.19
147 0.21
148 0.22
149 0.22
150 0.2
151 0.19
152 0.17
153 0.17
154 0.18
155 0.15
156 0.14
157 0.15
158 0.15
159 0.14
160 0.12
161 0.11
162 0.09
163 0.09
164 0.08
165 0.08
166 0.11
167 0.11
168 0.12
169 0.14
170 0.19
171 0.21
172 0.22
173 0.22
174 0.18
175 0.18
176 0.17
177 0.17
178 0.13
179 0.13
180 0.13
181 0.13
182 0.17
183 0.16
184 0.17
185 0.18
186 0.19
187 0.16
188 0.16
189 0.19
190 0.16
191 0.16
192 0.17
193 0.17
194 0.15
195 0.18
196 0.21
197 0.2
198 0.22
199 0.22
200 0.21
201 0.21
202 0.22
203 0.24
204 0.23
205 0.21
206 0.18
207 0.21
208 0.2
209 0.19
210 0.2
211 0.17
212 0.19
213 0.24
214 0.31
215 0.37