Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A175VZ90

Protein Details
Accession A0A175VZ90   
Localization Confidence Low
Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
114-134LGGRVSRRPMRRLGKKAKDEPBasic
NLS Segment(s)
PositionSequence
118-132VSRRPMRRLGKKAKD
Subcellular Location(s) cysk 13, cyto 4.5, mito 4, cyto_nucl 4, pero 3
Family & Domain DBs
InterPro View protein in InterPro  
IPR029035  DHS-like_NAD/FAD-binding_dom  
Amino Acid Sequences MVYLEEAHRQGEHIAELINRDLSACPDMVLVLGTSLKLSGPWEFVRQFARRVGANGGKVAYVNLAKPSQRGYSLFDYWAEWECDSRVQDLKSRLEFFHSAVTGSLPRRPLAYTLGGRVSRRPMRRLGKKAKDEP
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.12
2 0.12
3 0.13
4 0.14
5 0.14
6 0.12
7 0.12
8 0.12
9 0.13
10 0.13
11 0.12
12 0.1
13 0.1
14 0.1
15 0.09
16 0.09
17 0.06
18 0.05
19 0.05
20 0.05
21 0.05
22 0.05
23 0.05
24 0.05
25 0.06
26 0.07
27 0.1
28 0.12
29 0.16
30 0.16
31 0.18
32 0.24
33 0.24
34 0.25
35 0.24
36 0.25
37 0.21
38 0.23
39 0.26
40 0.24
41 0.23
42 0.22
43 0.2
44 0.17
45 0.17
46 0.15
47 0.11
48 0.08
49 0.07
50 0.09
51 0.1
52 0.1
53 0.11
54 0.13
55 0.13
56 0.14
57 0.15
58 0.17
59 0.2
60 0.21
61 0.21
62 0.19
63 0.18
64 0.18
65 0.19
66 0.15
67 0.11
68 0.1
69 0.1
70 0.12
71 0.13
72 0.14
73 0.15
74 0.15
75 0.2
76 0.25
77 0.29
78 0.31
79 0.33
80 0.31
81 0.32
82 0.32
83 0.28
84 0.28
85 0.23
86 0.2
87 0.17
88 0.19
89 0.18
90 0.18
91 0.2
92 0.17
93 0.17
94 0.18
95 0.19
96 0.19
97 0.2
98 0.26
99 0.25
100 0.27
101 0.33
102 0.35
103 0.36
104 0.37
105 0.42
106 0.44
107 0.48
108 0.48
109 0.51
110 0.59
111 0.69
112 0.76
113 0.78
114 0.8