Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A175VX43

Protein Details
Accession A0A175VX43   
Localization Confidence Low
Confidence Score 6.6
NoLS Segment(s)
PositionSequenceProtein Nature
7-26TNPTSVPKPKQPKGILKKTTHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 15, pero 5, nucl 4.5, cyto_nucl 4
Family & Domain DBs
InterPro View protein in InterPro  
IPR008576  MeTrfase_NTM1  
IPR029063  SAM-dependent_MTases_sf  
Gene Ontology GO:0008276  F:protein methyltransferase activity  
GO:0006480  P:N-terminal protein amino acid methylation  
Pfam View protein in Pfam  
PF05891  Methyltransf_PK  
Amino Acid Sequences MSAETATNPTSVPKPKQPKGILKKTTPTPWNQGCICHLSDAQVVQYLEKCKSALWSKDGLVIVKENLSIRGADVFDSRDSTVLREDRKFLSLFQQAGLRLVKAEFQRGLPATFLPVKMYALAQREED
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.49
2 0.55
3 0.64
4 0.7
5 0.74
6 0.77
7 0.82
8 0.8
9 0.75
10 0.77
11 0.74
12 0.74
13 0.67
14 0.62
15 0.6
16 0.56
17 0.57
18 0.5
19 0.45
20 0.39
21 0.39
22 0.34
23 0.27
24 0.23
25 0.19
26 0.19
27 0.17
28 0.15
29 0.15
30 0.14
31 0.12
32 0.15
33 0.15
34 0.15
35 0.16
36 0.15
37 0.12
38 0.17
39 0.22
40 0.22
41 0.23
42 0.24
43 0.24
44 0.28
45 0.29
46 0.24
47 0.19
48 0.16
49 0.13
50 0.11
51 0.12
52 0.07
53 0.08
54 0.08
55 0.07
56 0.06
57 0.08
58 0.08
59 0.08
60 0.08
61 0.09
62 0.09
63 0.11
64 0.11
65 0.11
66 0.11
67 0.11
68 0.15
69 0.18
70 0.21
71 0.21
72 0.24
73 0.24
74 0.26
75 0.26
76 0.22
77 0.25
78 0.26
79 0.25
80 0.24
81 0.25
82 0.23
83 0.25
84 0.25
85 0.18
86 0.14
87 0.14
88 0.17
89 0.16
90 0.2
91 0.18
92 0.19
93 0.25
94 0.25
95 0.26
96 0.22
97 0.21
98 0.21
99 0.23
100 0.23
101 0.19
102 0.19
103 0.18
104 0.18
105 0.2
106 0.2
107 0.21