Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A175WFX3

Protein Details
Accession A0A175WFX3    Localization Confidence Low Confidence Score 8.2
NoLS Segment(s)
PositionSequenceProtein Nature
1-21MARTKKKPTQLKKNEPQPEIYHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 14, mito_nucl 11.833, cyto_nucl 9.333, mito 8.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR027377  ZAR1/RTP1-5-like_Znf-3CxxC  
Pfam View protein in Pfam  
PF13695  zf-3CxxC  
Amino Acid Sequences MARTKKKPTQLKKNEPQPEIYTFPDLHDRILAALNDIIVPTPWYNSNINASTGEQYSTNVMGRFRCKNWRCSQAGWGSKKVGILIKGYPNNGYNAQVFGQRCKSCEKLGALKLDEESYVERVVYRLKKFAGVVMTPPPFLDIIDGPEHESDLSXRGVQKGPL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.91
2 0.83
3 0.78
4 0.71
5 0.66
6 0.58
7 0.51
8 0.44
9 0.35
10 0.34
11 0.36
12 0.32
13 0.27
14 0.24
15 0.21
16 0.18
17 0.21
18 0.19
19 0.12
20 0.12
21 0.11
22 0.11
23 0.1
24 0.09
25 0.06
26 0.08
27 0.07
28 0.08
29 0.09
30 0.12
31 0.13
32 0.15
33 0.2
34 0.19
35 0.21
36 0.2
37 0.2
38 0.19
39 0.18
40 0.17
41 0.12
42 0.12
43 0.12
44 0.11
45 0.12
46 0.11
47 0.12
48 0.14
49 0.18
50 0.21
51 0.23
52 0.32
53 0.34
54 0.41
55 0.47
56 0.53
57 0.52
58 0.5
59 0.54
60 0.51
61 0.56
62 0.51
63 0.46
64 0.39
65 0.36
66 0.34
67 0.29
68 0.23
69 0.16
70 0.14
71 0.15
72 0.19
73 0.2
74 0.2
75 0.21
76 0.2
77 0.21
78 0.2
79 0.19
80 0.14
81 0.14
82 0.14
83 0.16
84 0.16
85 0.17
86 0.24
87 0.22
88 0.23
89 0.27
90 0.29
91 0.26
92 0.31
93 0.32
94 0.32
95 0.36
96 0.4
97 0.36
98 0.34
99 0.33
100 0.29
101 0.24
102 0.18
103 0.15
104 0.12
105 0.11
106 0.1
107 0.09
108 0.1
109 0.17
110 0.23
111 0.23
112 0.26
113 0.26
114 0.29
115 0.29
116 0.32
117 0.3
118 0.24
119 0.25
120 0.28
121 0.29
122 0.26
123 0.26
124 0.23
125 0.18
126 0.17
127 0.17
128 0.11
129 0.13
130 0.16
131 0.16
132 0.17
133 0.17
134 0.18
135 0.15
136 0.15
137 0.12
138 0.12
139 0.14
140 0.16
141 0.17