Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A175VTI0

Protein Details
Accession A0A175VTI0    Localization Confidence Low Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
85-105GGNYKMKARKIRSYKVKTSWLHydrophilic
NLS Segment(s)
Subcellular Location(s) extr 16, mito 3, cyto 3, cyto_mito 3
Family & Domain DBs
Amino Acid Sequences MKASVLFLVIAPLASAWKLELWGSDGRKVTMNGSRDTDCKNIDFSPVLNVNRAKFSPKTDWRPDPDTFELYANKNCDKLSYRNDGGNYKMKARKIRSYKVKTSWL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.06
2 0.06
3 0.05
4 0.06
5 0.06
6 0.07
7 0.07
8 0.1
9 0.16
10 0.18
11 0.22
12 0.23
13 0.23
14 0.25
15 0.25
16 0.26
17 0.26
18 0.27
19 0.24
20 0.27
21 0.27
22 0.27
23 0.29
24 0.29
25 0.24
26 0.22
27 0.22
28 0.19
29 0.19
30 0.18
31 0.15
32 0.16
33 0.2
34 0.19
35 0.2
36 0.21
37 0.2
38 0.21
39 0.21
40 0.2
41 0.17
42 0.21
43 0.27
44 0.34
45 0.41
46 0.46
47 0.51
48 0.53
49 0.57
50 0.54
51 0.51
52 0.46
53 0.41
54 0.35
55 0.31
56 0.29
57 0.26
58 0.29
59 0.26
60 0.24
61 0.23
62 0.22
63 0.23
64 0.25
65 0.29
66 0.31
67 0.37
68 0.38
69 0.41
70 0.44
71 0.43
72 0.44
73 0.45
74 0.41
75 0.41
76 0.44
77 0.46
78 0.52
79 0.56
80 0.62
81 0.63
82 0.71
83 0.74
84 0.78
85 0.82