Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A175WCT8

Protein Details
Accession A0A175WCT8   
Localization Confidence Medium
Confidence Score 14.3
NoLS Segment(s)
PositionSequenceProtein Nature
3-25QDPHLYGQPPPKKQKKEMALSGSHydrophilic
300-322RREREEKAAKRKREIEERRKEIGBasic
NLS Segment(s)
PositionSequence
294-328ARTEASRREREEKAAKRKREIEERRKEIGEKRAKK
Subcellular Location(s) nucl 17.5, cyto_nucl 12.333, cyto 6, cyto_mito 5.333
Family & Domain DBs
InterPro View protein in InterPro  
IPR025066  CCDC174-like  
Pfam View protein in Pfam  
PF13300  DUF4078  
Amino Acid Sequences MPQDPHLYGQPPPKKQKKEMALSGSLAFTSQLSSLLATSSASAPDGTSSSTTTGRARPSKSKTTDLAGVKVKRSSKDGAASTEGSRDSKKLNLKSPLGTEESKAEREFARRKMESKARLYAAMQRGDYVGREIGLVDFDRKWAESQSNNNPDNPISSSDSDSDSDANVDTTIIEYTDEFGRLRRGTRAERMRMERRLARGAAAAVELDRMSALPKAPETLIYGDAVQAEAFTARDGFETMEELARKRDRSPTPPEAVHYQADREIRTKGVGFYKFSKEEAKREEEMKALEEERARTEASRREREEKAAKRKREIEERRKEIGEKRAKKIAESFLDGLGRDLVVNSTGRSGDDGGDGKGEVI
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.72
2 0.78
3 0.83
4 0.83
5 0.84
6 0.83
7 0.8
8 0.74
9 0.67
10 0.6
11 0.5
12 0.4
13 0.3
14 0.21
15 0.14
16 0.11
17 0.09
18 0.08
19 0.08
20 0.09
21 0.09
22 0.09
23 0.09
24 0.08
25 0.09
26 0.09
27 0.09
28 0.09
29 0.09
30 0.09
31 0.1
32 0.1
33 0.1
34 0.1
35 0.11
36 0.13
37 0.14
38 0.17
39 0.19
40 0.23
41 0.3
42 0.35
43 0.4
44 0.47
45 0.53
46 0.61
47 0.63
48 0.65
49 0.59
50 0.57
51 0.59
52 0.53
53 0.51
54 0.49
55 0.48
56 0.44
57 0.47
58 0.46
59 0.4
60 0.42
61 0.39
62 0.37
63 0.4
64 0.4
65 0.39
66 0.38
67 0.38
68 0.35
69 0.34
70 0.3
71 0.24
72 0.23
73 0.2
74 0.18
75 0.23
76 0.3
77 0.34
78 0.4
79 0.46
80 0.48
81 0.5
82 0.51
83 0.48
84 0.44
85 0.39
86 0.32
87 0.29
88 0.29
89 0.29
90 0.26
91 0.24
92 0.22
93 0.29
94 0.34
95 0.35
96 0.41
97 0.41
98 0.43
99 0.5
100 0.56
101 0.56
102 0.55
103 0.55
104 0.47
105 0.47
106 0.46
107 0.45
108 0.42
109 0.37
110 0.32
111 0.26
112 0.25
113 0.24
114 0.23
115 0.17
116 0.11
117 0.08
118 0.08
119 0.08
120 0.07
121 0.08
122 0.08
123 0.08
124 0.08
125 0.08
126 0.09
127 0.09
128 0.1
129 0.11
130 0.14
131 0.16
132 0.24
133 0.33
134 0.41
135 0.41
136 0.41
137 0.4
138 0.37
139 0.34
140 0.29
141 0.22
142 0.17
143 0.17
144 0.18
145 0.18
146 0.19
147 0.18
148 0.17
149 0.14
150 0.11
151 0.1
152 0.08
153 0.07
154 0.06
155 0.05
156 0.04
157 0.04
158 0.04
159 0.04
160 0.04
161 0.04
162 0.05
163 0.06
164 0.07
165 0.06
166 0.07
167 0.11
168 0.11
169 0.13
170 0.15
171 0.19
172 0.22
173 0.31
174 0.38
175 0.4
176 0.45
177 0.51
178 0.55
179 0.54
180 0.55
181 0.5
182 0.46
183 0.45
184 0.39
185 0.32
186 0.26
187 0.22
188 0.18
189 0.14
190 0.11
191 0.06
192 0.06
193 0.05
194 0.04
195 0.04
196 0.04
197 0.04
198 0.05
199 0.06
200 0.06
201 0.07
202 0.08
203 0.08
204 0.09
205 0.11
206 0.11
207 0.12
208 0.11
209 0.11
210 0.1
211 0.1
212 0.09
213 0.07
214 0.05
215 0.04
216 0.04
217 0.04
218 0.04
219 0.04
220 0.04
221 0.05
222 0.06
223 0.06
224 0.06
225 0.07
226 0.08
227 0.1
228 0.11
229 0.11
230 0.17
231 0.2
232 0.21
233 0.22
234 0.3
235 0.34
236 0.4
237 0.48
238 0.51
239 0.53
240 0.53
241 0.54
242 0.48
243 0.46
244 0.41
245 0.33
246 0.27
247 0.25
248 0.26
249 0.25
250 0.22
251 0.21
252 0.19
253 0.2
254 0.2
255 0.2
256 0.25
257 0.26
258 0.28
259 0.32
260 0.38
261 0.37
262 0.38
263 0.43
264 0.39
265 0.44
266 0.46
267 0.48
268 0.44
269 0.44
270 0.45
271 0.39
272 0.36
273 0.31
274 0.28
275 0.22
276 0.22
277 0.23
278 0.23
279 0.22
280 0.23
281 0.21
282 0.2
283 0.24
284 0.3
285 0.36
286 0.44
287 0.47
288 0.52
289 0.54
290 0.61
291 0.66
292 0.68
293 0.7
294 0.71
295 0.71
296 0.74
297 0.79
298 0.79
299 0.8
300 0.81
301 0.81
302 0.82
303 0.83
304 0.8
305 0.74
306 0.71
307 0.67
308 0.67
309 0.67
310 0.64
311 0.63
312 0.64
313 0.62
314 0.6
315 0.6
316 0.59
317 0.53
318 0.51
319 0.47
320 0.43
321 0.44
322 0.4
323 0.34
324 0.26
325 0.2
326 0.14
327 0.12
328 0.1
329 0.1
330 0.11
331 0.11
332 0.12
333 0.13
334 0.13
335 0.15
336 0.15
337 0.14
338 0.18
339 0.19
340 0.17
341 0.18